DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: dpr10 and lrit3b

Sequence 1:NP_729591.1 Gene:dpr10 FlyBaseID:FBgn0052057 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009305418.1 Gene:lrit3b ZFINID:ZDB-GENE-070424-130 Length:487 Species:Danio rerio

Alignment Length:138 Identity:31/139 (22%)
Similarity:53/139 (38%) Gaps:18/139 (13%)


  Fly    53 PYFDLTMPRNITSLVGKSAYLGCRVKHLGNKTVAWIRHRDLHILTVG----TYTYTTDQRFQTSY 113
            ||. :|....||:|:|.:..|.|.........:.||:....::...|    |.:....:||....
Zfish   279 PYV-VTSATKITALLGSTVLLRCEATGHPTPALMWIKSAKRNLYNQGCCKQTQSSLDTERFPKKL 342

  Fly   114 HRDIDE-------WT-LQIKWAQQRDAGVYECQISTQP-VRSYSVNLNIVDLI----DAETSDIM 165
            ...:.|       |: :.:......|||.|.|:..... :....|:||:|.::    |.:.||..
Zfish   343 FGYVQESPRVGVRWSVVSLNGISYSDAGEYRCRAQNMAGISEAVVSLNVVGVMAEYTDFKNSDQQ 407

  Fly   166 QQYYNDDA 173
            |.....|:
Zfish   408 QTTTKSDS 415

Known Domains:


GeneSequenceDomainRegion External IDIdentity
dpr10NP_729591.1 Ig 63..143 CDD:299845 19/92 (21%)
IG_like 210..297 CDD:214653
IGc2 217..287 CDD:197706
lrit3bXP_009305418.1 LRRNT 51..92 CDD:214470
leucine-rich repeat 69..89 CDD:275380
LRR_8 112..172 CDD:290566
leucine-rich repeat 114..137 CDD:275378
leucine-rich repeat 138..161 CDD:275378
LRR_8 160..214 CDD:290566
LRR_4 160..201 CDD:289563
leucine-rich repeat 162..185 CDD:275378
leucine-rich repeat 186..199 CDD:275378
leucine-rich repeat 215..230 CDD:275378
Ig 278..391 CDD:299845 25/113 (22%)
I-set 279..391 CDD:254352 25/113 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.