DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Dronc and Strica

Sequence 1:NP_524017.1 Gene:Dronc FlyBaseID:FBgn0026404 Length:450 Species:Drosophila melanogaster
Sequence 2:NP_001260718.1 Gene:Strica FlyBaseID:FBgn0033051 Length:527 Species:Drosophila melanogaster

Alignment Length:315 Identity:66/316 (21%)
Similarity:124/316 (39%) Gaps:59/316 (19%)


  Fly   126 TSRKSADIVDTPSPEASEGPCVS-------KLRNEPLGALT---PYV--GVVDGPE-----VKKS 173
            ||..||..:.:|...:|....:|       |..::||.:..   |::  |...|.:     |.:|
  Fly   223 TSSSSASSITSPPKPSSSVSSISSIFKSAPKQVDKPLSSTATPKPFISLGSSGGTKPKVTAVAQS 287

  Fly   174 KKIHGGDSAILGTYK---MQSRFNRGVLLMVNIMDYPDQNRRRIGAEKDSKSLIHLFQELNFTIF 235
            :...|..|..||..|   .:::.....:.:.|...:.::|..|.|:.:|.|.|...|::|...:.
  Fly   288 QDAQGTISTSLGISKSSLTKNKLKPARVYIFNHERFDNKNEFRKGSAQDVKVLRATFEQLKCKVE 352

  Fly   236 PYGNVNQDQFFKLLTMVTSSSYVQNTECFVMVLMTHG---NSVEGKEKVEFCDGSVVDMQKIKDH 297
            ...:.......|.:.|:.:..: ::....|:|:::||   :.:..|:.....|..||        
  Fly   353 VITDATLVTIKKTVRMLQTKDF-EDKSALVLVILSHGTRHDQIAAKDDDYSLDDDVV-------- 408

  Fly   298 FQTAKCPYLVNKPKVLMFPFCRGDEYDLGHPKNQGNLMEPVYTAQEEKWPDTQTEGIPSPSTNVP 362
            |...:...|.:|||::....|:||       ...|..|...          .|..|.|:      
  Fly   409 FPILRNRTLKDKPKLIFVQACKGD-------CQLGGFMTDA----------AQPNGSPN------ 450

  Fly   363 SLADTLVCYANTPGYVTHRDLDTGSWYIQKFCQVMADHAHDTDLEDILKKTSEAV 417
               :.|.||:...|:|:.|..| |:.:||..|:.:......:|::.|:....:.|
  Fly   451 ---EILKCYSTYEGFVSFRTED-GTPFIQTLCEALNRSGKTSDIDTIMMNVRQVV 501

Known Domains:


GeneSequenceDomainRegion External IDIdentity
DroncNP_524017.1 CARD 18..106 CDD:260018
CASc 186..443 CDD:237997 47/239 (20%)
StricaNP_001260718.1 CASc 311..523 CDD:294037 46/228 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3573
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10454
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.