DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ANKRD27

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_115515.2 Gene:ANKRD27 / 84079 HGNCID:25310 Length:1050 Species:Homo sapiens


Alignment Length:286 Identity:70/286 - (24%)
Similarity:114/286 - (39%) Gaps:43/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PTSSPNTHGEWPHMNINLNLNMSSNPSTNASFQLSRDRGEHFALPHLPPLPLNPNASNAEYL--- 124
            |..||....:    :|:...:.||..|.:||.:....:.::..:..|.....:.:.....||   
Human   631 PVQSPQRSVD----SISQESSTSSFSSMSASSRQEETKKDYREVEKLLRAVADGDLEMVRYLLEW 691

  Fly   125 ----------------PSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYSNIIVQSNGRKLRTAAST 173
                            |...||  |....|....:.|:.::..|....|:..|.....|..||..
Human   692 TEEDLEDAEDTVSAADPEFCHP--LCQCPKCAPAQKRLAKVPASGLGVNVTSQDGSSPLHVAALH 754

  Fly   174 CNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVI 238
            ...:|:..:|:.|||..|.:.....|||||..:|:..:|:.||...|.||..|..|||||    |
Human   755 GRADLIPLLLKHGANAGARNADQAVPLHLACQQGHFQVVKCLLDSNAKPNKKDLSGNTPL----I 815

  Fly   239 SASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTT 303
            .|.|...:.:|.:|||.|||::.  .:||....|.||.:            |....:.::.:|..
Human   816 YACSGGHHELVALLLQHGASINA--SNNKGNTALHEAVI------------EKHVFVVELLLLHG 866

  Fly   304 LILRYMVKQQRELEDLSALEKRLQNL 329
            ..::.:.|:||...|.:....::..|
Human   867 ASVQVLNKRQRTAVDCAEQNSKIMEL 892

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 37/95 (39%)
ANK repeat 167..193 CDD:293786 9/25 (36%)
ANK 170..276 CDD:238125 40/105 (38%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 15/34 (44%)
ANKRD27NP_115515.2 Sufficient for GEF activity towards RAB21. /evidence=ECO:0000269|PubMed:16525121 1..372
VPS9 264..363 CDD:308039
Sufficient for interaction with VPS29. /evidence=ECO:0000269|PubMed:24856514 396..460
Interaction with RAB32. /evidence=ECO:0000250|UniProtKB:Q3UMR0 451..730 18/104 (17%)
Interaction with RAB38. /evidence=ECO:0000250|UniProtKB:Q3UMR0, ECO:0000269|PubMed:18477474 451..600
ANK 458..585 CDD:238125
ANK repeat 462..493 CDD:293786
ANK repeat 495..526 CDD:293786
ANK repeat 564..595 CDD:293786
Ank_2 <567..>896 CDD:330894 70/286 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 625..665 9/37 (24%)
Required for interaction with VAMP7. /evidence=ECO:0000250|UniProtKB:Q3UMR0, ECO:0000269|PubMed:19745841, ECO:0000269|PubMed:23104059 658..707 3/48 (6%)
ANK repeat 673..741 CDD:293786 11/69 (16%)
Sufficient for interaction with VPS29. /evidence=ECO:0000269|PubMed:24856514 692..746 9/55 (16%)
ANK 738..863 CDD:238125 45/142 (32%)
ANK repeat 743..774 CDD:293786 9/30 (30%)
ANK 8 743..772 8/28 (29%)
ANK 9 776..805 11/28 (39%)
ANK repeat 780..807 CDD:293786 12/26 (46%)
ANK repeat 809..840 CDD:293786 15/36 (42%)
ANK 10 809..838 15/32 (47%)
ANK repeat 842..873 CDD:293786 6/42 (14%)
ANK 11 842..871 6/40 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 987..1050
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.