DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and SKOR

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_186934.1 Gene:SKOR / 821052 AraportID:AT3G02850 Length:828 Species:Arabidopsis thaliana


Alignment Length:135 Identity:45/135 - (33%)
Similarity:68/135 - (50%) Gaps:15/135 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 KLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGN 230
            ||.:||...::..|..::..|.:||..|...||||||||.|||..|...|::...:.|:.|.||:
plant   551 KLNSAAFYGDLYQLKSLIRAGGDPNKTDYDGRSPLHLAASRGYEDITLYLIQESVDVNIKDKLGS 615

  Fly   231 TPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAK----LRLLRN-------RY 284
            |||    :.|..|..:.|..:|::.||::::.:........:|:..    .|||.|       .|
plant   616 TPL----LEAIKNGNDRVAALLVKEGATLNIENAGTFLCTVVAKGDSDFLKRLLSNGIDPNSKDY 676

  Fly   285 DHPTP 289
            ||.||
plant   677 DHRTP 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 34/95 (36%)
ANK repeat 167..193 CDD:293786 7/25 (28%)
ANK 170..276 CDD:238125 34/105 (32%)
ANK repeat 195..226 CDD:293786 14/30 (47%)
ANK repeat 228..263 CDD:293786 11/34 (32%)
SKORNP_186934.1 PLN03192 70..827 CDD:215625 45/135 (33%)
ANK repeat 580..611 CDD:293786 14/30 (47%)
ANK repeat 613..644 CDD:293786 11/34 (32%)
ANK repeat 677..708 CDD:293786 4/5 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.