DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and tp53bp2b

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_005161866.1 Gene:tp53bp2b / 568138 ZFINID:ZDB-GENE-050208-453 Length:1063 Species:Danio rerio


Alignment Length:299 Identity:77/299 - (25%)
Similarity:116/299 - (38%) Gaps:76/299 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ITPPPPAMPPTPTSSPNTHGEWPHMNINLNLNMSSNPSTNASFQLSRDR---GEHFALPHL---P 110
            :||||  :||..          |.::.|.|.:...|..     ||..::   |.....|::   |
Zfish   754 LTPPP--LPPRS----------PILDDNSNFSTGLNEP-----QLKEEQEVYGPAAPEPYVEEYP 801

  Fly   111 PLPLNPNASNAEY-----------LPSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYSNIIVQSNG 164
            |.|..|..|..|.           .|.:.....||.|.::...:...:|:.|     .:.|:.|.
Zfish   802 PYPPPPYPSMTEQEGPGEDSINMKAPEVTGQVMLPPGKRTNLRKTGSERINH-----GMRVRFNP 861

  Fly   165 RKLRTAAS-TCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSL 228
            ..|...:| ....:|:.||:....:|:..::...:.||.|.|.|:..||:.|::||.|.|..||.
Zfish   862 LALLLDSSLEGEYDLVQRIIYEVDDPSLPNDEGITALHNAVCAGHTEIVKFLVQYGVNVNAADSD 926

  Fly   229 GNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLR------------ 281
            |.||||.|   ||.||.. |...|::.||:|:....|:   |:.|..|...:.            
Zfish   927 GWTPLHCA---ASCNNVQ-VCKFLVESGAAVYAMTYSD---LQTAADKCEEMEEGYAQCSQFLYG 984

  Fly   282 --------NR--------YDHPTPETAKILEDMCMLTTL 304
                    ||        ||..:|:.....|..| ||.|
Zfish   985 VQEKMGIMNRGVVYALWDYDGESPDELSFKEGDC-LTVL 1022

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 35/96 (36%)
ANK repeat 167..193 CDD:293786 6/26 (23%)
ANK 170..276 CDD:238125 37/106 (35%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 15/34 (44%)
tp53bp2bXP_005161866.1 RA <20..82 CDD:214612
RILP-like <173..310 CDD:304877
Ank_2 865..951 CDD:289560 31/89 (35%)
ANK repeat 865..891 CDD:293786 5/25 (20%)
ANK 871..982 CDD:238125 37/117 (32%)
ANK repeat 893..924 CDD:293786 12/30 (40%)
ANK repeat 926..955 CDD:293786 15/32 (47%)
SH3_ASPP2 995..1051 CDD:212886 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.