DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and asb13b

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_684802.4 Gene:asb13b / 556808 ZFINID:ZDB-GENE-091118-116 Length:294 Species:Danio rerio


Alignment Length:166 Identity:43/166 - (25%)
Similarity:72/166 - (43%) Gaps:24/166 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNT 231
            |..|....|.:.:..:::.||...|.|.:..:|||:|..|.::..|:.||..|||.|.. .|..|
Zfish   127 LHEACMGGNSKCVQLMIDEGALMEAHDCHFGTPLHVACARQHLDCVKVLLNAGANVNAA-KLHET 190

  Fly   232 PLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELA-EAKLRLLRNRYDHPTPETAKIL 295
            .||.|   |...|.. ::.:|::.|.::...|...|.|::.. .:....|...:...||.:   |
Zfish   191 ALHHA---AKVKNLE-LIELLVEFGGNIFARDNLGKKPIQYTRSSSASALCLEFYESTPLS---L 248

  Fly   296 EDMCMLTTLILRYMVKQQRELEDLSALEKRLQNLST 331
            :.:|.::   ||            :||.||...:.|
Zfish   249 QQLCRIS---LR------------NALGKRALGVFT 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 28/95 (29%)
ANK repeat 167..193 CDD:293786 6/25 (24%)
ANK 170..276 CDD:238125 30/106 (28%)
ANK repeat 195..226 CDD:293786 12/30 (40%)
ANK repeat 228..263 CDD:293786 9/34 (26%)
asb13bXP_684802.4 Ank_4 26..78 CDD:290365
ANK repeat 26..55 CDD:293786
ANK 52..176 CDD:238125 13/48 (27%)
ANK repeat 57..88 CDD:293786
Ank_2 62..147 CDD:289560 3/19 (16%)
ANK repeat 90..118 CDD:293786
Ank_2 127..218 CDD:289560 28/95 (29%)
ANK repeat 155..185 CDD:293786 12/29 (41%)
ANK repeat 187..218 CDD:293786 9/34 (26%)
ANK 190..216 CDD:197603 8/29 (28%)
SOCS_ASB13 243..284 CDD:239699 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.