DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and tnks2

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001017008.2 Gene:tnks2 / 549762 XenbaseID:XB-GENE-968819 Length:1167 Species:Xenopus tropicalis


Alignment Length:173 Identity:54/173 - (31%)
Similarity:83/173 - (47%) Gaps:36/173 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 SNGRK---LRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPN 223
            |:|||   |..||....::::..:|:.||:.:|.|:.:..|||.|...|:..:.:.|:|.||:.|
 Frog   208 SDGRKSTPLHLAAGYNRVKIVQLLLQHGADVHAKDKGDLVPLHNACSYGHYEVTELLVKRGASVN 272

  Fly   224 VVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPT 288
            .:|....||||    .|:|.|...|..:||..||...|.:..|||.::||             ||
 Frog   273 AMDLWQFTPLH----EAASKNRVEVCSLLLSYGADPTMLNCHNKSAIDLA-------------PT 320

  Fly   289 PETAKILEDMCMLTTLILRYMVKQQRELE-----DLSALEKRL 326
            |:    |::|       |.|..|....|:     ||:.::|.|
 Frog   321 PQ----LKEM-------LSYEFKGHSLLQAAREADLTRVKKHL 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 32/95 (34%)
ANK repeat 167..193 CDD:293786 7/25 (28%)
ANK 170..276 CDD:238125 36/105 (34%)
ANK repeat 195..226 CDD:293786 10/30 (33%)
ANK repeat 228..263 CDD:293786 13/34 (38%)
tnks2NP_001017008.2 PTZ00322 28..>114 CDD:140343
ANK repeat 61..89 CDD:293786
PHA02876 <74..>438 CDD:165207 54/173 (31%)
ANK repeat 91..122 CDD:293786
ANK repeat 124..155 CDD:293786
ANK repeat 214..242 CDD:293786 7/27 (26%)
ANK repeat 244..275 CDD:293786 10/30 (33%)
ANK repeat 277..308 CDD:293786 13/34 (38%)
ANKYR 310..>472 CDD:223738 18/67 (27%)
ANK repeat 366..398 CDD:293786
ANK repeat 400..431 CDD:293786
ANK repeat 434..522 CDD:293786
PHA03095 495..>804 CDD:222980
ANK repeat 529..557 CDD:293786
ANK repeat 559..590 CDD:293786
ANK repeat 592..623 CDD:293786
ANK repeat 645..675 CDD:293786
ANK repeat 682..710 CDD:293786
ANK repeat 712..743 CDD:293786
ANK repeat 745..776 CDD:293786
SAM_tankyrase1,2 872..937 CDD:188923
tankyrase_like 940..1161 CDD:238718
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.