DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10809 and ANKRD52

DIOPT Version :9

Sequence 1:	NP_001163403.1	Gene:	CG10809 / 39159	FlyBaseID:	FBgn0036052	Length:	358	Species:	Drosophila melanogaster
Sequence 2:	NP_775866.2	Gene:	ANKRD52 / 283373	HGNCID:	26614	Length:	1076	Species:	Homo sapiens

Alignment Length:	173	Identity:	55/173 - (31%)
Similarity:	83/173 - (47%)	Gaps:	28/173 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly   175 NIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVIS 239
            ::|.:..:|....|.|..|:..|:|||.||..|.:||:|.||..|||.|..|:|..||||.|
Human    20 DVEEVRSLLSQKENINVLDQERRTPLHAAAYVGDVPILQLLLMSGANVNAKDTLWLTPLHRA--- 81

  Fly   240 ASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTTL 304
            |:|.| ..|:|:||...|.|:..|:..::||.:|.|      ||       ..|..|.:..|.:.
Human    82 AASRN-EKVLGLLLAHSADVNARDKLWQTPLHVAAA------NR-------ATKCAEALAPLLSS 132

  Fly   305 I----------LRYMVKQQRELEDLSALEKRLQNLSTSDDQEQ 337
            :          |.:.| ....||.::.|..:..:|:..|.:|:
Human   133 LNVADRSGRSALHHAV-HSGHLETVNLLLNKGASLNVCDKKER 174

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10809	NP_001163403.1	Ank_2	167..263	CDD:289560	37/87 (43%)
		ANK repeat	167..193	CDD:293786	4/17 (24%)
		ANK	170..276	CDD:238125	41/100 (41%)
		ANK repeat	195..226	CDD:293786	16/30 (53%)
		ANK repeat	228..263	CDD:293786	15/34 (44%)
ANKRD52	NP_775866.2	ANK 1	7..36		3/15 (20%)
		Ank_4	11..61	CDD:290365	15/40 (38%)
		ANK repeat	11..38	CDD:293786	4/17 (24%)
		ANK	35..193	CDD:238125	52/158 (33%)
		ANK repeat	40..71	CDD:293786	16/30 (53%)
		ANK 2	40..69		15/28 (54%)
		Ank_2	45..170	CDD:289560	46/142 (32%)
		ANK 3	73..102		15/32 (47%)
		ANK repeat	76..104	CDD:293786	14/31 (45%)
		ANK 4	106..135		9/41 (22%)
		ANK repeat	108..137	CDD:293786	9/41 (22%)
		Ank_2	111..203	CDD:289560	16/78 (21%)
		ANK	134..259	CDD:238125	8/42 (19%)
		ANK repeat	139..170	CDD:293786	6/31 (19%)
		ANK 5	139..168		6/29 (21%)
		ANK repeat	172..203	CDD:293786	1/3 (33%)
		ANK 6	172..201		1/3 (33%)
		Ank_2	177..269	CDD:289560
		ANK repeat	205..236	CDD:293786
		ANK 7	205..234
		ANK 8	238..267
		ANK repeat	238..266	CDD:293786
		Ank_2	243..336	CDD:289560
		ANK	266..392	CDD:238125
		ANK 9	271..301
		ANK repeat	272..303	CDD:293786
		ANK repeat	305..336	CDD:293786
		ANK 10	305..334
		ANK	333..476	CDD:238125
		ANK 11	338..367
		ANK repeat	338..363	CDD:293786
		Ank_4	339..392	CDD:290365
		ANK 12	371..400
		ANK repeat	375..420	CDD:293786
		Ank_2	376..486	CDD:289560
		ANK	417..570	CDD:238125
		ANK 13	422..451
		ANK repeat	423..453	CDD:293786
		ANK repeat	455..486	CDD:293786
		ANK 14	455..484
		Ank_2	460..575	CDD:289560
		ANK repeat	488..547	CDD:293786
		ANK 15	488..545
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	502..522
		ANK 16	549..579
		ANK 17	584..613
		ANK	587..708	CDD:238125
		ANK repeat	587..615	CDD:293786
		Ank_2	589..682	CDD:289560
		ANK 18	617..646
		ANK repeat	618..648	CDD:293786
		ANK 19	651..680
		ANK repeat	653..685	CDD:293786
		Ank_2	656..751	CDD:289560
		ANK	682..811	CDD:238125
		ANK repeat	687..718	CDD:293786
		ANK 20	687..716
		ANK repeat	720..751	CDD:293786
		ANK 21	720..749
		ANK repeat	753..784	CDD:293786
		ANK 22	753..782
		Ank_2	758..855	CDD:289560
		ANK 23	790..819
		ANK repeat	822..855	CDD:293786
ANK 24	822..852
ANK	852..981	CDD:238125
ANK repeat	857..888	CDD:293786
ANK 25	857..886
Ank_2	862..955	CDD:289560
ANK repeat	890..922	CDD:293786
ANK 26	890..920
ANK repeat	924..991	CDD:293786
ANK 27	924..953
ANK repeat	928..958	CDD:293786
Ank_2	929..1016	CDD:289560
ANK 28	960..989
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910