DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and Ankrd54

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001365917.1 Gene:Ankrd54 / 223690 MGIID:2444209 Length:307 Species:Mus musculus


Alignment Length:266 Identity:91/266 - (34%)
Similarity:137/266 - (51%) Gaps:37/266 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LPPLPLNPNASNAEYLPSL----IHP-----STLPSGSKSFKMRPRMQRLKHSYSYSNIIVQSNG 164
            ||...:....|:..||..|    :.|     ..:|:|......||. :||..:....:.:     
Mouse    52 LPGRSVGRAQSSLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPH-RRLGPTGKEVHAL----- 110

  Fly   165 RKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLG 229
            ::||.:|:..::|.:.::||.||:|.|||:..|:.||.|:|.|...|||.||.:||:||..|.||
Mouse   111 KRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQQDGLG 175

  Fly   230 NTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLELAEAKLRLLRN---------RYD 285
            |||||||   |.:|:..|:. .||:|||.|...||:.::||.||::||.:|:.         |.:
Mouse   176 NTPLHLA---ACTNHVPVIT-TLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLE 236

  Fly   286 HPTPETAKILEDMCMLTTLILRYMVKQQRE-LEDLSALEKRLQNLSTSDDQEQVVSQTADELLAS 349
            ...|......:.:.||...:.|....:||| |:||..   |||..||.:..::|.     :||||
Mouse   237 VKQPAAPTSFQIIHMLREYLERLGRHEQRERLDDLCT---RLQMTSTKEQVDEVT-----DLLAS 293

  Fly   350 VERLSI 355
            ...||:
Mouse   294 FTSLSL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 46/95 (48%)
ANK repeat 167..193 CDD:293786 10/25 (40%)
ANK 170..276 CDD:238125 50/105 (48%)
ANK repeat 195..226 CDD:293786 15/30 (50%)
ANK repeat 228..263 CDD:293786 18/34 (53%)
Ankrd54NP_001365917.1 Ank_2 117..205 CDD:403870 44/91 (48%)
ANK repeat 141..172 CDD:293786 15/30 (50%)
ANK repeat 174..205 CDD:293786 18/34 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BJ6N
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I4849
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto92334
orthoMCL 1 0.900 - - OOG6_108203
Panther 1 1.100 - - LDO PTHR24197
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5638
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.