DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and ankrd2

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:XP_021336623.1 Gene:ankrd2 / 101886079 ZFINID:ZDB-GENE-090313-383 Length:303 Species:Danio rerio


Alignment Length:215 Identity:55/215 - (25%)
Similarity:101/215 - (46%) Gaps:13/215 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 QRLKHSYSYSNIIVQSNG----RKLRTAASTCNIELLNRILEGGANPNAADEYNRSPLHLAACRG 207
            :::|:..:.|..|...:|    .:...||:...:|::.|.|:.|.:||..||:.::.||.||.:.
Zfish    88 KKIKNKTTLSKDITNVSGAVEPEEFLKAAAQGKMEVVERFLDDGGDPNTCDEFRKTALHRAALQN 152

  Fly   208 YIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVVGVLLQGGASVHMYDRSNKSPLEL 272
            :..||::||..||:.|..|.||...:|.|....|.:    .:.||...||.:::.|:...|||.:
Zfish   153 HTKIVEKLLDKGADINFKDRLGCRAVHWACRGGSLS----ALTVLQDRGADINVRDKLLSSPLHV 213

  Fly   273 A--EAKLRLLRNRYDHPTPETAKILEDMCMLTTLIL--RYMVKQQRELEDLSALEKRLQNLSTSD 333
            |  .....::::..|......||..|...:|...:.  ||.:.:|..|.......|..:.::.::
Zfish   214 ATRTGHSDVVQHLLDSGININAKDWEGDTVLHDAVRFNRYKIVKQLILAGADMQIKNAEGITATE 278

  Fly   334 DQEQVVSQTADELLASVERL 353
            ..:|....| .|.|..:|::
Zfish   279 QVKQWQFDT-KETLEKLEQM 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 31/95 (33%)
ANK repeat 167..193 CDD:293786 8/25 (32%)
ANK 170..276 CDD:238125 36/107 (34%)
ANK repeat 195..226 CDD:293786 11/30 (37%)
ANK repeat 228..263 CDD:293786 9/34 (26%)
ankrd2XP_021336623.1 ANK 135..260 CDD:238125 37/128 (29%)
ANK repeat 143..171 CDD:293786 11/27 (41%)
ANK repeat 174..204 CDD:293786 8/33 (24%)
ANK repeat 206..237 CDD:293786 6/30 (20%)
ANK repeat 239..270 CDD:293786 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.