Sequence 1: | NP_001163403.1 | Gene: | CG10809 / 39159 | FlyBaseID: | FBgn0036052 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001106279.3 | Gene: | FPGT-TNNI3K / 100526835 | HGNCID: | 42952 | Length: | 936 | Species: | Homo sapiens |
Alignment Length: | 200 | Identity: | 52/200 - (26%) |
---|---|---|---|
Similarity: | 89/200 - (44%) | Gaps: | 52/200 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 120 NAEYLPSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYSNIIVQSNGRKLRTAASTCNIELLNRILE 184
Fly 185 GGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVV 249
Fly 250 GVLLQGG--ASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTTLILRYMVKQ 312
Fly 313 QRELE 317 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10809 | NP_001163403.1 | Ank_2 | 167..263 | CDD:289560 | 34/97 (35%) |
ANK repeat | 167..193 | CDD:293786 | 8/25 (32%) | ||
ANK | 170..276 | CDD:238125 | 36/107 (34%) | ||
ANK repeat | 195..226 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 228..263 | CDD:293786 | 12/36 (33%) | ||
FPGT-TNNI3K | NP_001106279.3 | ANK repeat | 167..199 | CDD:293786 | |
Ank_2 | 172..265 | CDD:403870 | 18/72 (25%) | ||
ANK repeat | 201..232 | CDD:293786 | 9/33 (27%) | ||
PHA03095 | 221..>515 | CDD:222980 | 48/192 (25%) | ||
ANK repeat | 235..265 | CDD:293786 | 8/35 (23%) | ||
ANK repeat | 267..298 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 300..333 | CDD:293786 | 12/36 (33%) | ||
ANK repeat | 335..363 | CDD:293786 | 7/51 (14%) | ||
ANK repeat | 370..403 | CDD:293786 | |||
ANK repeat | 405..438 | CDD:293786 | |||
ANK repeat | 440..470 | CDD:293786 | |||
PKc_TNNI3K | 570..823 | CDD:270966 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |