DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10809 and FPGT-TNNI3K

DIOPT Version :9

Sequence 1:NP_001163403.1 Gene:CG10809 / 39159 FlyBaseID:FBgn0036052 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_001106279.3 Gene:FPGT-TNNI3K / 100526835 HGNCID:42952 Length:936 Species:Homo sapiens


Alignment Length:200 Identity:52/200 - (26%)
Similarity:89/200 - (44%) Gaps:52/200 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 NAEYLPSLIHPSTLPSGSKSFKMRPRMQRLKHSYSYSNIIVQSNGRKLRTAASTCNIELLNRILE 184
            |||.:.||:|     ||:.       :|::    .|..:..      |..|....::|..:.:|:
Human   214 NAELITSLLH-----SGAD-------IQQV----GYGGLTA------LHIATIAGHLEAADVLLQ 256

  Fly   185 GGANPNAADEYNRSPLHLAACRGYIPIVQQLLKYGANPNVVDSLGNTPLHLAVISASSNNFNVVV 249
            .|||.|..|....:|||:||..|:..:.:.|||:||:.||...:|:.||||    ||:..|..:.
Human   257 HGANVNIQDAVFFTPLHIAAYYGHEQVTRLLLKFGADVNVSGEVGDRPLHL----ASAKGFLNIA 317

  Fly   250 GVLLQGG--ASVHMYDRSNKSPLELAEAKLRLLRNRYDHPTPETAKILEDMCMLTTLILRYMVKQ 312
            .:|::.|  |.|:..|..:..||...        :|:.|..                |::|:::.
Human   318 KLLMEEGSKADVNAQDNEDHVPLHFC--------SRFGHHD----------------IVKYLLQS 358

  Fly   313 QRELE 317
            ..|::
Human   359 DLEVQ 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10809NP_001163403.1 Ank_2 167..263 CDD:289560 34/97 (35%)
ANK repeat 167..193 CDD:293786 8/25 (32%)
ANK 170..276 CDD:238125 36/107 (34%)
ANK repeat 195..226 CDD:293786 13/30 (43%)
ANK repeat 228..263 CDD:293786 12/36 (33%)
FPGT-TNNI3KNP_001106279.3 ANK repeat 167..199 CDD:293786
Ank_2 172..265 CDD:403870 18/72 (25%)
ANK repeat 201..232 CDD:293786 9/33 (27%)
PHA03095 221..>515 CDD:222980 48/192 (25%)
ANK repeat 235..265 CDD:293786 8/35 (23%)
ANK repeat 267..298 CDD:293786 13/30 (43%)
ANK repeat 300..333 CDD:293786 12/36 (33%)
ANK repeat 335..363 CDD:293786 7/51 (14%)
ANK repeat 370..403 CDD:293786
ANK repeat 405..438 CDD:293786
ANK repeat 440..470 CDD:293786
PKc_TNNI3K 570..823 CDD:270966
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.