DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk8 and Cdk12

Sequence 1:NP_536735.2 Gene:Cdk8 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001262167.1 Gene:Cdk12 FlyBaseID:FBgn0037093 Length:1157 Species:Drosophila melanogaster

Alignment Length:387 Identity:125/388 (32%)
Similarity:190/388 (49%) Gaps:92/388 (24%)


  Fly    26 KVGRGTYGHVYKAKWKETSDGKEYALKQI----DGTGLSMSACREIALLRELKHQNVITLIRVFL 86
            ::|.||||.||||:...|:|  ..|||::    :..|..::|.|||.:||:|.|:|::.|..:..
  Fly   809 QIGEGTYGQVYKARDHHTND--MVALKKVRLEHEKEGFPITAVREIKILRQLNHRNIVNLHEIVT 871

  Fly    87 SHND----RK----VFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMV-------KSLLYQIL 136
            ...|    ||    .:|:.:|.:|||..:::               .|||       .|::.|:|
  Fly   872 DKQDAVEFRKDKGSFYLVFEYMDHDLMGLLE---------------SGMVDFNEENNASIMKQLL 921

  Fly   137 DGIHYLHSNWVLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAP--LKPLADLDPVVVTFWY 199
            ||::|.|....||||:|.:|||:    |.||:||:||.|.|||:||.  .:|..:   .|:|.||
  Fly   922 DGLNYCHKKNFLHRDIKCSNILM----NNRGKVKLADFGLARLYNADDRERPYTN---KVITLWY 979

  Fly   200 RAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQD 264
            |.||||||...|..:||:|:.|||..||....|:|....|         ..||:.|..:.|.|..
  Fly   980 RPPELLLGEERYGPSIDVWSCGCILGELFVKRPLFQANAE---------MAQLETISKICGSPVP 1035

  Fly   265 KDWEDIKKMPEHHTLTKDFKRSTYSTCSLAKYMERHKIKPD-----SKAFHLLQKLLLMDPNKRI 324
            ..|.::.|:|..|||.:             |...|.:::.|     :.|..||.|:|.:||:|||
  Fly  1036 AVWPNVIKLPLFHTLKQ-------------KKTHRRRLREDFEFMPAPALDLLDKMLDLDPDKRI 1087

  Fly   325 TSEQAMQDQYFQ-----EEPQPTQDVFAGCPIPYPKREFLTDDDQEDKSDNKRQQQQQQQQQ 381
            |:|.|::..:.:     |.|.|....:..|...:.|               ||::|.::||:
  Fly  1088 TAEDALRSPWLRKINPDEMPTPQLPTWQDCHELWSK---------------KRRRQMREQQE 1134

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 115/335 (34%)
S_TKc 22..335 CDD:214567 115/335 (34%)
Cdk12NP_001262167.1 STKc_CDK12 796..1098 CDD:270847 115/335 (34%)
S_TKc 804..1098 CDD:214567 115/335 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111348041
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24056
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.