DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cdk8 and dyf-18

Sequence 1:NP_536735.2 Gene:Cdk8 FlyBaseID:FBgn0015618 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_502232.2 Gene:dyf-18 WormBaseID:WBGene00010349 Length:323 Species:Caenorhabditis elegans

Alignment Length:347 Identity:118/348 (34%)
Similarity:173/348 (50%) Gaps:48/348 (14%)


  Fly    19 LFNYEGCKV-GRGTYGHVYKAKWKETSDGKEYALKQIDGTGLS-MSACREIALLRELKHQNVITL 81
            ::.||..:| |||.:|.|..|  ::|...|..|:|:|....:| :|..|||:.||.|.|:|::.|
 Worm     5 IYRYETIQVAGRGAFGLVVIA--RDTLTSKRVAIKRIMVPNVSKVSLAREISCLRNLHHRNILKL 67

  Fly    82 IRVFLSHNDRKVFLLIDYAEHDLWHIIKFHRAAKATKKQVVVPRGMVKSLLYQILDGIHYLHSNW 146
            :..|.|.:  .:.::.:...:.|..|||.....|..:        ..:....|||.||.||||..
 Worm    68 LDCFPSAD--LMSIVTEEVPYTLGDIIKDKTRPKTEQ--------FNRWYYTQILSGIAYLHSKE 122

  Fly   147 VLHRDLKPANILVMGDGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHY 211
            ::|||:||.||||    ..|..|||||.|.| .|..|..|..:.|..|.|.||||||||.|::.|
 Worm   123 IMHRDIKPENILV----TSRNVVKIADFGQA-CFYMPKDPNQEYDVNVATRWYRAPELLFGSKKY 182

  Fly   212 TKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIKKMPEH 276
            ...:||||||||.|||:..:|||..|.|         .:|:..||.|:|.|.:.:|.:.:.||:.
 Worm   183 KPDVDIWAIGCILAELVRGKPIFPGRSE---------LEQISIIFGVLGTPNEDNWPNWRTMPDA 238

  Fly   277 HTLTKDFK--RSTYSTCSLAK---------------YMERHKIKPDSKAFHLLQKLLLMDPNKRI 324
            :.|..:.|  |:.::...|.|               :.:|.|.....|...:.|.|.|::||.||
 Worm   239 NKLLFEPKEPRNNWTEILLCKEISNNFTEFLGSHLQFFKRLKASELLKEPWIKQGLPLVEPNYRI 303

  Fly   325 TSEQAMQDQYFQEEPQPTQDVF 346
            :.:...::   |.:..|...||
 Worm   304 SKKSTRRN---QRDALPPLHVF 322

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Cdk8NP_536735.2 STKc_CDK8_like 19..335 CDD:270834 114/335 (34%)
S_TKc 22..335 CDD:214567 114/332 (34%)
dyf-18NP_502232.2 PKc_like 7..289 CDD:304357 107/308 (35%)
S_TKc 8..290 CDD:214567 107/308 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111330500
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24056
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.