DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ilp1 and Igf1

DIOPT Version :10

Sequence 1:NP_648359.1 Gene:Ilp1 / 39149 FlyBaseID:FBgn0044051 Length:154 Species:Drosophila melanogaster
Sequence 2:XP_006513318.1 Gene:Igf1 / 16000 MGIID:96432 Length:197 Species:Mus musculus


Alignment Length:128 Identity:33/128 - (25%)
Similarity:42/128 - (32%) Gaps:53/128 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 AMAMVTPTGSGHQLLPPGNHKLCGPALSDAMDVVC-PHGFNTLPRKRESLLGNSDDDEDTEQEVQ 90
            |:.::|.|.|    ...|...|||..|.||:..|| |.||                         
Mouse    74 ALCLLTFTSS----TTAGPETLCGAELVDALQFVCGPRGF------------------------- 109

  Fly    91 DDSSMWQTLDGAGYSFSPLLTNLYGSEVLIKMRRHRRHLTGGVYDECCVKTCSYLELAIYCLP 153
                         |...|   ..|||.:       ||....|:.||||.::|....|.:||.|
Mouse   110 -------------YFNKP---TGYGSSI-------RRAPQTGIVDECCFRSCDLRRLEMYCAP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ilp1NP_648359.1 IlGF_insulin_bombyxin_like <131..151 CDD:239832 7/19 (37%)
Igf1XP_006513318.1 IlGF 87..154 CDD:239834 29/111 (26%)

Return to query results.
Submit another query.