DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18178 and Mak16

Sequence 1:NP_001261647.1 Gene:CG18178 FlyBaseID:FBgn0036035 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001014024.1 Gene:Mak16 RGDID:1311297 Length:293 Species:Rattus norvegicus

Alignment Length:97 Identity:33/98 (34%)
Similarity:57/98 (58%) Gaps:10/98 (10%)


  Fly     7 ESASEEEEVQSENSEASDEEELQAEDSDEDQLQADDSEDEDSDGSEL-DLDASDTESDEDD--GE 68
            :.|.|::|.:|::.:..||||.:.||..:.:...|| |.|:||.|:. |:|..:|:|:|||  ..
  Rat   187 DKALEKQEAESDSEDEEDEEEDEEEDVGKREFVEDD-EVEESDLSDFEDMDKLNTDSEEDDESSR 250

  Fly    69 EEDTIKPQPKSRAEI---IDEK---IHTKYEQ 94
            ||:..|.:.|.:|.:   :.:|   :..:|||
  Rat   251 EEEAHKAKHKGKAPLKGPLRKKRAYVEIEYEQ 282

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18178NP_001261647.1 RRM_6 220..285 CDD:290958
Mak16NP_001014024.1 MAK16 2..285 CDD:227458 33/98 (34%)
Ribosomal_L28e 6..116 CDD:280030
Mak16 148..>194 CDD:282698 2/7 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23405
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.