DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG18178 and C16A3.6

Sequence 1:NP_001261647.1 Gene:CG18178 FlyBaseID:FBgn0036035 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_498395.1 Gene:C16A3.6 WormBaseID:WBGene00015811 Length:323 Species:Caenorhabditis elegans

Alignment Length:149 Identity:37/150 (25%)
Similarity:63/150 (42%) Gaps:40/150 (27%)


  Fly    12 EEEVQSENSEASDEEELQAEDSD--EDQLQAD----DSEDED-SDGSELDLDASDT--------- 60
            |:.:::...|...|:||:.:|:|  |.|..||    |.||:| .||.:......||         
 Worm   187 EQMLENTEKELEVEQELEQDDADTGETQFVADFDSSDDEDQDMEDGGDGHWSPGDTDSENEDNWQ 251

  Fly    61 ------ESDEDD---GEEEDTIKPQPKSRAEIIDEKIHTKYEQLKGTRLYVRFPQKLPLDLDEFN 116
                  :|||||   |:|...|:..||.:.: .:.|..|..:...|.:..::....:.::.:|  
 Worm   252 PEQEQEDSDEDDEEGGDEPMEIEEPPKKKVK-KEPKKKTGKKAADGKKKKLKKRAHVEIEYEE-- 313

  Fly   117 AKVKALHPLVLKSTKPRQK 135
                        .|:|||:
 Worm   314 ------------ETEPRQR 320

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG18178NP_001261647.1 RRM_6 220..285 CDD:290958
C16A3.6NP_498395.1 PLN00040 1..191 CDD:215038 1/4 (25%)
Ribosomal_L28e 6..115 CDD:280030
Mak16 148..231 CDD:282698 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR23405
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.