DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc4 and ube2ka

Sequence 1:NP_001287013.1 Gene:Ubc4 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001013500.1 Gene:ube2ka ZFINID:ZDB-GENE-050320-48 Length:200 Species:Danio rerio

Alignment Length:199 Identity:134/200 (67%)
Similarity:163/200 (82%) Gaps:0/200 (0%)


  Fly     1 MANMAVSRIKREFKEVMRSEEIVQCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPET 65
            |||:||.|||||||||::|||..:..||::||::::||||||||||||||||||::.||||:|||
Zfish     1 MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEIKIPET 65

  Fly    66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130
            ||||||||||||:|||||||||||||||||||..|||||||||||||||||||||||||||||||
Zfish    66 YPFNPPKVRFITKIWHPNISSVTGAICLDILKGQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVV 130

  Fly   131 AYQFKDKYDLFLLTAKHWTNAYAGGPHTFPDCDSKIQRLRDMGIDEHEARAVLSKENWNLEKATE 195
            |.|:|...::|..||:.|::..||.|.:.|:...||.:|..||.|::.....||.::|::|.|||
Zfish   131 ANQYKQNPEMFKQTARLWSHVCAGAPVSSPEYTRKIDKLCAMGFDKNAVIVALSSKSWDVEAATE 195

  Fly   196 GLFS 199
            .|.|
Zfish   196 LLLS 199

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 115/152 (76%)
UQ_con 8..149 CDD:278603 110/141 (78%)
UBA_II_E2_UBCD4 163..198 CDD:270574 14/35 (40%)
ube2kaNP_001013500.1 COG5078 1..148 CDD:227410 114/147 (78%)
UBCc 6..148 CDD:238117 110/142 (77%)
UBA_like_SF 163..200 CDD:304366 15/38 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C327827775
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H3903
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1418652at2759
OrthoFinder 1 1.000 FOG0002559
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR24068
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.