DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ubc4 and UBE2D4

Sequence 1:NP_001287013.1 Gene:Ubc4 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:XP_024302563.1 Gene:UBE2D4 HGNCID:21647 Length:192 Species:Homo sapiens

Alignment Length:130 Identity:59/131 (45%)
Similarity:78/131 (60%) Gaps:3/131 (2%)


  Fly    24 QCSIKIELVNDSWTELRGEIAGPPDTPYEGGKFVLEIKVPETYPFNPPKVRFITRIWHPNISSVT 88
            |||  ...|.|.....:..|.||.|:||:||.|.|.|..|..|||.||||.|.|:|:||||:| .
Human    65 QCS--AGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINS-N 126

  Fly    89 GAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVAYQFKDKYDLFLLTAKHWTNAYA 153
            |:||||||:..|:.|:|:..||||:.:||....||||....:|:.:|...:.:...|:.||..||
Human   127 GSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYA 191

  Fly   154  153
            Human   192  191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 58/129 (45%)
UQ_con 8..149 CDD:278603 56/125 (45%)
UBA_II_E2_UBCD4 163..198 CDD:270574
UBE2D4XP_024302563.1 UBCc 54..191 CDD:320784 58/129 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5078
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.