DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubc4 and CG46338

DIOPT Version :9

Sequence 1:NP_001287013.1 Gene:Ubc4 / 39133 FlyBaseID:FBgn0015321 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_524888.1 Gene:CG46338 / 47272 FlyBaseID:FBgn0285962 Length:244 Species:Drosophila melanogaster


Alignment Length:135 Identity:27/135 - (20%)
Similarity:55/135 - (40%) Gaps:18/135 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MAVSRIKREFK-----EVMRSEEIVQCSIKIELVND-SWTELRGEIAGPPDTPYEGGKFVLEIKV 62
            :.::.|::|:|     :::.||::....:.....|. .|.   |...|.... |....|...|.:
  Fly    14 LLITTIQQEYKILAEYKMIESEKLSGIYVIPSYANSLQWF---GVFFGRQGL-YAESVFRFTILL 74

  Fly    63 PETYPFNP--PKVRFITRIWHPNISSVTGAICLDILKDNWAAAMT-LRTVLLSLQALLAAAEPDD 124
            |:.:|.:.  |.:.|...:.||::...|.::.:......|..... |..:|..||.:.:     |
  Fly    75 PDRFPDDKSLPSIIFQQDVIHPHVCPYTHSLDVSHAFPEWRCGEDHLWQLLKYLQVIFS-----D 134

  Fly   125 PQDAV 129
            |.|::
  Fly   135 PLDSI 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubc4NP_001287013.1 COG5078 1..153 CDD:227410 27/135 (20%)
UQ_con 8..149 CDD:278603 27/131 (21%)
UBA_II_E2_UBCD4 163..198 CDD:270574
CG46338NP_524888.1 UBCc 19..169 CDD:294101 27/130 (21%)
COG5078 24..176 CDD:227410 25/125 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.