DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG16717 and mpped2a

Sequence 1:NP_648343.1 Gene:CG16717 FlyBaseID:FBgn0036028 Length:300 Species:Drosophila melanogaster
Sequence 2:NP_001017735.1 Gene:mpped2a ZFINID:ZDB-GENE-050417-241 Length:294 Species:Danio rerio

Alignment Length:299 Identity:134/300 (45%)
Similarity:178/300 (59%) Gaps:27/300 (9%)


  Fly     3 VPVHPLSQDPTAAWREISKTQRVIK---VTMKPPTTTVAP---NKARVVCMSDTHSLTPYIKFDI 61
            :.|...|.:||.|....:..|...:   |.|..|.:...|   ...|.||:|||||.|..|:  :
Zfish    13 ISVDEYSSNPTQALTHYNINQSRFQPPHVHMVDPISYDTPKPGGHTRFVCVSDTHSRTDGIQ--M 75

  Fly    62 PDGDIFIHAGDFTKCGQLEEVEEFNTWIGALPHRHKIVIAGNHELSFDRTFTHPFQKSKSHASSS 126
            |.||:.:|.||||:.|...||::||.|:|:||:..|:||||||||:||:.|.....|...:.   
Zfish    76 PYGDVLLHTGDFTELGLPSEVKKFNDWLGSLPYEFKVVIAGNHELTFDKDFMTELVKQDYYR--- 137

  Fly   127 KHTGMSILDDLPTLGNAKENLESAVQTQNVRDVLTNCRYLEDELLEIWGIQIYGSPWQPEFCRWA 191
                      .|::...|..     ...||:.:||||.||:|..:.:.|.:|||:||.|.|..|.
Zfish   138 ----------FPSVSKLKPK-----DFDNVQSLLTNCVYLQDSDVTVKGFRIYGTPWTPWFNGWG 187

  Fly   192 FNVPRGTACLDKWNQIPEGIDILVTHTPPVGHGDLCCSGV-RAGCVELLSTVQQRVRPKYHVFGH 255
            ||:|||.:.|||||.||||:|||:||.||:|..|.....: |.||||||:|||:|||||.||||.
Zfish   188 FNLPRGQSLLDKWNLIPEGVDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGG 252

  Fly   256 VHEGYGITSDGRIIFVNASTCDINYLPNNAPIVFDVTLP 294
            :||||||.:||...|:|||||.:::.|.|.|||||:..|
Zfish   253 IHEGYGIMTDGYTTFINASTCTVSFQPTNPPIVFDLPNP 291

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG16717NP_648343.1 MPP_239FB 43..274 CDD:277325 113/232 (49%)
Metallophos 43..258 CDD:278574 103/216 (48%)
mpped2aNP_001017735.1 MPP_239FB 59..271 CDD:277325 113/232 (49%)
Metallophos 59..255 CDD:278574 103/216 (48%)
PHA03008 <112..255 CDD:165309 75/161 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C284214391
eggNOG 1 0.900 E1_KOG3947
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1301937at2759
OrthoFinder 1 1.000 FOG0002363
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128827
Panther 1 1.100 O PTHR12905
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.810

Return to query results.
Submit another query.