DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and AgaP_AGAP010615

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_001237581.1 Gene:AgaP_AGAP010615 / 4577718 VectorBaseID:AGAP010615 Length:272 Species:Anopheles gambiae


Alignment Length:274 Identity:74/274 - (27%)
Similarity:118/274 - (43%) Gaps:40/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVVAASPGFNRTSLLPQVTISEGA--EGRIVNGYPAPEGKAPYIVGLLIRTDG 63
            :.|.|..|....||:..:...|:         .:||  .||||||......|..|.:.|.:    
Mosquito     5 ISLVLFGLFCGSAVLTDASDQNK---------PDGASQSGRIVNGKAVSIVKYKYALSLRV---- 56

  Fly    64 SNSAAVGAGTIIASDWILTAAHCLTTD-----YVEIHYGSNWGWNGAFRQSVRRDNFISHPNW-- 121
             |.......|||.....||||||:...     .|.::.||.....|....||.|  ...||.:  
Mosquito    57 -NGVFECGATIITHKHALTAAHCVYPQRFEPMRVSLYGGSTSAVTGGVLFSVVR--IAVHPGYDH 118

  Fly   122 ---PAEGGRDIGLIRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDNGNLA--DWLQ 181
               |.....|:.::...:..|:...|..:|  ..:.|::.:.|.|...|||...|...|  :.|:
Mosquito   119 SYFPDASEYDVAVLTVANNAFSGKPNMASL--ILQTSEQPIGTRCFVAGWGRTGNNEPASLNQLR 181

  Fly   182 CMDVQIISNSECEQSYGT-----VASTDMCTRRTDGKSSCGGDSGGPLVTHDNARLVGVITFGSV 241
            ..::.|:..|.|.:::.|     |.|..:|.:..:|..:|.|||||.||.  ...|.||::|.::
Mosquito   182 YAEMTIVDQSTCARAWATYPRQRVTSNMICAKYGNGVDTCKGDSGGALVC--GGGLAGVVSFTNL 244

  Fly   242 DCHSG-PSGYTRVT 254
            :|.|. |:|:::::
Mosquito   245 ECTSAWPAGFSKIS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/234 (28%)
Tryp_SPc 40..263 CDD:238113 64/233 (27%)
AgaP_AGAP010615XP_001237581.1 Tryp_SPc 36..259 CDD:214473 65/234 (28%)
Tryp_SPc 37..258 CDD:238113 64/231 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.