DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:260 Identity:82/260 - (31%)
Similarity:128/260 - (49%) Gaps:44/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIH 95
            ||:.|.. ::..|..|.||:.|:...|    ..:|....|| |:|::.|::|||||    :|...
  Rat   179 TITPGGH-KVAGGQDAEEGEWPWQASL----QQNNVHRCGA-TLISNSWLITAAHC----FVRSA 233

  Fly    96 YGSNWGWNGAF-------RQSVRRDNFISHPN--WPAEGGRDIGLIRTPS-VGFTDLINKVALP- 149
            ...:|..:..|       :::|:  :.:.|.|  :||. ..||.::|..| |.:.:.|.:..|| 
  Rat   234 NPKDWKVSFGFLLSKPQAQRAVK--SIVIHENYSYPAH-NNDIAVVRLSSPVLYENNIRRACLPE 295

  Fly   150 ---SFSEESDRFVDTWCVACGWGGM-DNGNLADWLQCMDVQIISNSECE--QSYGTVASTDM-CT 207
               .|...||      .|..|||.: .:|:..:.||...|:||.|..|.  ::||.|.:..| |.
  Rat   296 ATQKFPPNSD------VVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCA 354

  Fly   208 RRTDGK-SSCGGDSGGPLVTHDNAR---LVGVITFGSVDC--HSGPSGYTRVTDYLGWIRDNTGI 266
            ...:|: .:|.||||||||:.|:..   |.|::::|. :|  .:.|..|||||.|..||...||:
  Rat   355 GFLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGD-ECALPNKPGVYTRVTHYRDWISSKTGL 418

  Fly   267  266
              Rat   419  418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 75/244 (31%)
Tryp_SPc 40..263 CDD:238113 77/246 (31%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 75/244 (31%)
Tryp_SPc 187..415 CDD:238113 77/246 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.