DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Tmprss11b

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_795998.2 Gene:Tmprss11b / 319875 MGIID:2442893 Length:416 Species:Mus musculus


Alignment Length:262 Identity:81/262 - (30%)
Similarity:124/262 - (47%) Gaps:32/262 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 NRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHC 86
            ||....|:::   ....||..|..|.:|:.|:...|  |.:|.:..  || ::|...::||||||
Mouse   170 NRCGRRPRMS---ATYDRITGGSTAHKGEWPWQASL--RVNGKHYC--GA-SLIGERFLLTAAHC 226

  Fly    87 L----TTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIR-TPSVGFTDLINKV 146
            .    ....:.:.:|:.  ...|:.|...::..|.......|...|:.:|: |..|.|.:.:::|
Mouse   227 FQGTNNPKNLTVSFGTR--VTPAYMQHSVQEIIIHEDYVKGEHHDDVAVIKLTEKVSFNNDVHRV 289

  Fly   147 ALPSFSEESDRF-VDTWCVACGWGGMD-NGNLADWLQCMDVQIISNSEC--EQSY-GTVASTDMC 206
            .||   |.:..| .....|..|||... ||.....||...::||..:.|  |::| |.:..|.:|
Mouse   290 CLP---ESTQIFPPGEGVVVTGWGSFSYNGKSPLLLQKASIKIIDTNTCNSEEAYGGRIVDTMLC 351

  Fly   207 TRRTDGK-SSCGGDSGGPLVTHDNAR----LVGVITFGSVDCH--SGPSGYTRVTDYLGWIRDNT 264
            ....:|. .:|.|||||||| |.|:|    |||::::|. :|.  :.|..|.|||.|..||...|
Mouse   352 AGYLEGSIDACQGDSGGPLV-HPNSRDIWYLVGIVSWGH-ECGRVNKPGVYMRVTSYRNWIASKT 414

  Fly   265 GI 266
            ||
Mouse   415 GI 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/237 (31%)
Tryp_SPc 40..263 CDD:238113 74/239 (31%)
Tmprss11bNP_795998.2 SEA 46..140 CDD:279699
Tryp_SPc 184..410 CDD:214473 73/237 (31%)
Tryp_SPc 185..413 CDD:238113 74/239 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.