DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Gzmm

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:251 Identity:67/251 - (26%)
Similarity:112/251 - (44%) Gaps:40/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVE-------- 93
            |.:|:.|..|.....||:|.|     .:..:.|..|.::...|:|||||||:....:        
  Rat    24 EAQIIGGREAVPHSRPYMVSL-----QNTKSHVCGGVLVHQKWVLTAAHCLSEPLQQLKLVFGLH 83

  Fly    94 -IHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIR-----TPSVGFTDLINKVALPSFS 152
             :|...:.|.....:|:::      ||.:..:...|:.|::     .||..    :..:|||  .
  Rat    84 SLHDPQDPGLTFYIKQAIK------HPGYNLKYENDLALLKLDGRVKPSKN----VKPLALP--R 136

  Fly   153 EESDRFVD-TWCVACGWG-GMDNGNLADWLQCMDVQIISNSECEQS---YGTVASTDMCTRR-TD 211
            :..|:..: :.|...||| ....|.||..||.:|::::....|..|   .|.:..:.:|.:. ..
  Rat   137 KPRDKPAEGSRCSTAGWGITHQRGQLAKSLQELDLRLLDTRMCNNSRFWNGVLTDSMLCLKAGAK 201

  Fly   212 GKSSCGGDSGGPLVTHDNARLVGVITFGSVDCHS--GPSGYTRVTDYLGWIRDNTG 265
            |::.|.||||||||. ...::.|:::|.|.:|..  .|:..|.|..|..|||...|
  Rat   202 GQAPCKGDSGGPLVC-GKGKVDGILSFSSKNCTDIFKPTVATAVAPYSSWIRKVIG 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 62/242 (26%)
Tryp_SPc 40..263 CDD:238113 65/244 (27%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 65/244 (27%)
Trypsin 27..251 CDD:278516 62/241 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.