DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and Klk1

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_036725.1 Gene:Klk1 / 24523 RGDID:2969 Length:261 Species:Rattus norvegicus


Alignment Length:286 Identity:76/286 - (26%)
Similarity:131/286 - (45%) Gaps:55/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFLLTLSVALAVV-AASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGS 64
            |...:|.|.::|..: ||.||                :.|::.||...:...|:.|.|.     |
  Rat     1 MWFLILFLDLSLGQIDAAPPG----------------QSRVIGGYKCEKNSQPWQVALY-----S 44

  Fly    65 NSAAVGAGTIIASDWILTAAHCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFIS----HPNW---- 121
            .:..:..|.:|...|::|||||.:.:| ::..|.|   |....:...:...:|    ||::    
  Rat    45 FTKYLCGGVLIDPSWVITAAHCSSNNY-QVWLGRN---NLLEDEPFAQHRLVSQSFPHPDYKPFL 105

  Fly   122 -------PAEG-GRDIGLIR-TPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMDN--GN 175
                   |.:. ..|:.|:. :.....||.:..:.||  :||..  |.:.|:|.|||....  ..
  Rat   106 MRNHTRKPGDDHSNDLMLLHLSQPADITDGVKVIDLP--TEEPK--VGSTCLASGWGSTKPLIWE 166

  Fly   176 LADWLQCMDVQIISNSECEQSY-GTVASTDMCTRRTD-GKSSCGGDSGGPLVTHDNARLVGVITF 238
            ..|.|||:::.::||.:|.::| ..|....:|....: ||.:|.|||||||:.  :..|.|:.::
  Rat   167 FPDDLQCVNIHLLSNEKCIKAYKEKVTDLMLCAGELEGGKDTCTGDSGGPLLC--DGVLQGITSW 229

  Fly   239 GSVDC--HSGPSGYTRVTDYLGWIRD 262
            |||.|  .:.|:.||::..:..||::
  Rat   230 GSVPCAKTNMPAIYTKLIKFTSWIKE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 66/243 (27%)
Tryp_SPc 40..263 CDD:238113 67/246 (27%)
Klk1NP_036725.1 Tryp_SPc 24..253 CDD:214473 66/243 (27%)
Tryp_SPc 25..256 CDD:238113 67/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.