DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CLIPB16

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_320055.4 Gene:CLIPB16 / 1280226 VectorBaseID:AGAP009263 Length:406 Species:Anopheles gambiae


Alignment Length:292 Identity:74/292 - (25%)
Similarity:117/292 - (40%) Gaps:60/292 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VAASPGFNRTSLLPQVTISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVG------AGT 73
            |..||.|| ....|........:|...||.    |..|::..:     |..:...|      :|:
Mosquito   128 VVTSPTFN-DQRAPAACGKSIVQGDFYNGL----GAYPFVARI-----GFKNTKTGTFIFPCSGS 182

  Fly    74 IIASDWILTAAHCLTT-------------DYVEIHYGSNWGWNG-----AFRQSVRRDNFISHPN 120
            |||...:||:|||...             || :.....:.|..|     |...:|  ...|.||:
Mosquito   183 IIARQIVLTSAHCALAKAESHRLSSVRVGDY-DTRTDPDCGSTGFCAPVAINHAV--SQIIVHPD 244

  Fly   121 WPAEG--GRDIGL--IRTPSVGFTDLINKVALPSFSEESDRFVDTWCVACGWGGMD-NGNLADWL 180
            : .||  ..||.|  :||| :.:|.....:.|  .:.:.|..|.......|||.:. :...:..|
Mosquito   245 Y-IEGQYHHDIALLILRTP-INYTVAAQPICL--HARKQDLTVGRRVQIIGWGKLSTSAAKSPEL 305

  Fly   181 QCMDVQIISNSECEQSYGTVASTD---------MCTRRTDGKSSCGGDSGGPLVTHDNARL--VG 234
            |.::|.:.|..:|.::|.:..:..         ||. ..:|:.:|.|..|.||:..|..|.  :|
Mosquito   306 QSLEVPLTSWDKCVRAYASTGALQSPQSIDGEWMCA-GGEGRDACHGFGGAPLIIRDQGRYAQIG 369

  Fly   235 VITFGSVDCH--SGPSGYTRVTDYLGWIRDNT 264
            :::||:..|.  :.||.||.:..|..||..|:
Mosquito   370 IMSFGAETCGALNMPSVYTSIAHYAPWIEANS 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 64/262 (24%)
Tryp_SPc 40..263 CDD:238113 66/264 (25%)
CLIPB16XP_320055.4 CLIP 88..126 CDD:295450
Tryp_SPc 157..400 CDD:238113 64/255 (25%)
Tryp_SPc 157..397 CDD:214473 62/252 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.