DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and AgaP_AGAP009211

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_319989.4 Gene:AgaP_AGAP009211 / 1280170 VectorBaseID:AGAP009211 Length:265 Species:Anopheles gambiae


Alignment Length:261 Identity:67/261 - (25%)
Similarity:113/261 - (43%) Gaps:52/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVE----IHY---- 96
            |..|.||.....|::.  |:.|..|:....| |::|:...|||||||:.....:    ||:    
Mosquito     9 IAYGQPARAYAFPWMA--LLETSVSDDLPCG-GSLISDRHILTAAHCVKARKRDCDDRIHFKDDE 70

  Fly    97 ----------GSNWGWN-GAFRQSVRRDNFISHPNWPAEGGR-DIGLIRT--PS-VGFTDLINKV 146
                      |:.:..: |...|.:..:..::||.:.|...| |:.:||.  |: :|:.  :..:
Mosquito    71 YDSGESEEADGAEYSASCGPPAQRIPIETIVTHPKYSARSKRNDLAIIRLQYPAIIGYN--VIPI 133

  Fly   147 ALPSFSEE------SDRFVDTWCVACGWGGMDNGNLADWLQCMDVQIISNSECE---QSYGTVAS 202
            .|| .:|:      :|.||      .|||..:.|..:..|:...:..:...:|.   :....:..
Mosquito   134 CLP-LTEQLRAYRPADSFV------TGWGLTETGQRSAVLRYAILPALPLPDCAMRIKELDRIIV 191

  Fly   203 TD---MCTRRTDGKSSCGGDSGGPL-VTHDNARLV--GVITFGSVDCHS--GPSGYTRVTDYLGW 259
            .|   :|....:..:.|.||||||| ...|:.|.|  ||::||...|.:  .|..:..||.::.|
Mosquito   192 LDDGHLCAGGNNRTAHCHGDSGGPLQYVSDSTRFVLQGVVSFGVKTCGTKIAPGVFANVTHFIDW 256

  Fly   260 I 260
            |
Mosquito   257 I 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 65/259 (25%)
Tryp_SPc 40..263 CDD:238113 67/261 (26%)
AgaP_AGAP009211XP_319989.4 Tryp_SPc 9..257 CDD:214473 65/259 (25%)
Tryp_SPc 9..257 CDD:238113 65/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.