DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and AgaP_AGAP003626

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_313388.5 Gene:AgaP_AGAP003626 / 1274290 VectorBaseID:AGAP003626 Length:305 Species:Anopheles gambiae


Alignment Length:247 Identity:75/247 - (30%)
Similarity:116/247 - (46%) Gaps:33/247 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 NGYPAPEGKAPY--IVGLLIRTDGSNSAAV--GAGTIIASDWILTAAHCL-TTDYVEIHYG-SNW 100
            ||.||.||:.|:  .||.....|..::|.:  .:|.:|:..::|.||||| |....|:..| .::
Mosquito    57 NGLPAREGEFPHQVRVGQWFYEDEDDTAFILRCSGALISDRYVLIAAHCLWTLGDEEVSLGRHDY 121

  Fly   101 GWNGAFRQ-SVRRDNFISHPNWPAE---GGRDIGLIR-TPSVGFTDLINKVALPSFSEESDRFVD 160
            ..||.|.: |::||:.|.||::..:   ...||.|:| ...|.||..|....|.:..|.::   .
Mosquito   122 TRNGTFPELSIKRDDLILHPSYDEQTKASYNDIALVRLAQPVTFTSHIYPACLWTEEEAAE---P 183

  Fly   161 TWCVACGWGGMDNGNLADWLQCMDVQI--ISNSECEQSYGT-------VASTDMCTRR-TDGKSS 215
            |...:.|:.....|.|.| .:.:.:|:  :.|:||.:.|..       |....:|... .:.||.
Mosquito   184 TKLTSSGFTMGRLGKLRD-TRLVKIQVSRVPNAECSREYTDSGYYPQGVTDALLCAESPVEWKSL 247

  Fly   216 CGGDSGGPLVT--HDNA---RLVGVITFGSVDCHSGPSG--YTRVTDYLGWI 260
            |.||:||.|.|  .|:|   ||:||...|. :|......  :|:|...|.||
Mosquito   248 CEGDAGGLLQTLDRDSADVYRLIGVEAKGH-ECDQSHQKFIFTKVRQQLDWI 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 73/245 (30%)
Tryp_SPc 40..263 CDD:238113 75/247 (30%)
AgaP_AGAP003626XP_313388.5 Tryp_SPc 57..301 CDD:238113 75/247 (30%)
Tryp_SPc 57..298 CDD:214473 73/245 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.