DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and CLIPB5

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_313032.4 Gene:CLIPB5 / 1273975 VectorBaseID:AGAP004148 Length:379 Species:Anopheles gambiae


Alignment Length:281 Identity:79/281 - (28%)
Similarity:114/281 - (40%) Gaps:54/281 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 LLPQVTISEGAEG-----RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASD-WILTAA 84
            |||    |.|..|     ||..|......:.|:| .||.....:|......|.::.:| ::|||:
Mosquito   101 LLP----SPGQCGIQTSDRIFGGVNTRIDEFPWI-ALLKYAKPNNVFGFHCGGVLINDRYVLTAS 160

  Fly    85 HCL-------TTDYVEIHYGSNWGWNGAFRQ----------------SVRRDNFISHPNW---PA 123
            ||:       |.:..|:..|.   |:.:..|                .|..:..|.||.:   .|
Mosquito   161 HCVNGKDIPSTWNLAEVRLGE---WDTSTAQDCEGLGDDVDCSPPPIDVPIEGKIPHPEYVPTSA 222

  Fly   124 EGGRDIGLIR-TPSVGFTDLINKVALPSFSEESDR-FVDTWCVACGWGGMDNGNLADWLQCMDVQ 186
            |...||.|:| ..||.::|.|..:.||..:|...| :|.......|||.......::..|.:.|.
Mosquito   223 EQYNDIALLRLQQSVPYSDFIKPICLPMQAELKARDYVGFRMQVAGWGRTATARFSNVKQKVAVD 287

  Fly   187 IISNSECEQSYG----TVASTDMCTRRTDGKSSCGGDSGGPLVTHDNA------RLVGVITFGSV 241
            .:|...|.|.|.    .:..:.:|.....||.||.|||||||.....|      .|:|:::||..
Mosquito   288 GVSLDACNQVYQREQVLLRQSQLCAGGEAGKDSCQGDSGGPLTGVHTAGGLQYWYLIGLVSFGPT 352

  Fly   242 DCHSG--PSGYTRVTDYLGWI 260
            .|...  |..||:|..|:.||
Mosquito   353 PCGQAGWPGVYTKVDQYVDWI 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 71/261 (27%)
Tryp_SPc 40..263 CDD:238113 72/262 (27%)
CLIPB5XP_313032.4 CLIP 33..87 CDD:288855
Tryp_SPc 115..373 CDD:214473 71/261 (27%)
Tryp_SPc 116..373 CDD:238113 70/260 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.