| Sequence 1: | NP_648340.1 | Gene: | CG18179 / 39124 | FlyBaseID: | FBgn0036023 | Length: | 268 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_031752400.1 | Gene: | tmprss2.12 / 100497514 | XenbaseID: | XB-GENE-22065925 | Length: | 497 | Species: | Xenopus tropicalis | 
| Alignment Length: | 256 | Identity: | 79/256 - (30%) | 
|---|---|---|---|
| Similarity: | 120/256 - (46%) | Gaps: | 46/256 - (17%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    32 ISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHY 96 
  Fly    97 GSNWGWNGAFRQSVRR-----------DNFISHPNWPAE-GGRDIGLIR-TPSVGFTDLINKVAL 148 
  Fly   149 PSFSEESDRFVDTW-----CVACGWG-GMDNGNLADWLQCMDVQIISNSECEQSY---GTVASTD 204 
  Fly   205 MCT-RRTDGKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCHS--GPSGYTRVTDYLGWI 260 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG18179 | NP_648340.1 | Tryp_SPc | 39..260 | CDD:214473 | 75/247 (30%) | 
| Tryp_SPc | 40..263 | CDD:238113 | 76/248 (31%) | ||
| tmprss2.12 | XP_031752400.1 | LDLa | 127..155 | CDD:238060 | |
| SRCR_2 | 160..255 | CDD:406055 | 0/1 (0%) | ||
| Tryp_SPc | 261..489 | CDD:238113 | 74/246 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||