DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18179 and tmprss2.12

DIOPT Version :9

Sequence 1:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster
Sequence 2:XP_031752400.1 Gene:tmprss2.12 / 100497514 XenbaseID:XB-GENE-22065925 Length:497 Species:Xenopus tropicalis


Alignment Length:256 Identity:79/256 - (30%)
Similarity:120/256 - (46%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ISEGAEGRIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCLTTDYVEIHY 96
            :|...|.|||.|..|..|..|:.|.|  :.|.:|   :..|::||::||:|||||:..|   ...
 Frog   253 LSTYGESRIVGGSSASIGDWPWQVNL--QYDDTN---LCGGSVIAANWIVTAAHCVQGD---TSS 309

  Fly    97 GSNWGWNGAFRQSVRR-----------DNFISHPNWPAE-GGRDIGLIR-TPSVGFTDLINKVAL 148
            .|.|   .||...::.           |..|.||::.:: ...||.|:: ..|:.|:.:...|.|
 Frog   310 PSLW---KAFIGKIKMPSYYDSSAYSVDRIIVHPDYSSQTNSNDIALMKLKTSIAFSSISRPVCL 371

  Fly   149 PSFSEESDRFVDTW-----CVACGWG-GMDNGNLADWLQCMDVQIISNSECEQSY---GTVASTD 204
            |::..:       |     |...||| ....|:::..|:...|.:||.:.|.|:.   |.:.|:.
 Frog   372 PNYGMQ-------WEEGQPCYISGWGTTSQKGSISSVLKYAMVPLISPTTCNQTIMYNGAITSSM 429

  Fly   205 MCT-RRTDGKSSCGGDSGGPLVTHDNAR--LVGVITFGSVDCHS--GPSGYTRVTDYLGWI 260
            :|. ....|..||.|||||||||..|:.  |||..::|. .|.:  .|..|..:|.:|.||
 Frog   430 ICAGYPKGGVDSCQGDSGGPLVTKTNSLWWLVGDTSWGD-GCANVYRPGVYGNMTVFLQWI 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 75/247 (30%)
Tryp_SPc 40..263 CDD:238113 76/248 (31%)
tmprss2.12XP_031752400.1 LDLa 127..155 CDD:238060
SRCR_2 160..255 CDD:406055 0/1 (0%)
Tryp_SPc 261..489 CDD:238113 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.