DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir67a and Ir75b

DIOPT Version :9

Sequence 1:NP_648329.3 Gene:Ir67a / 39110 FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001137966.2 Gene:Ir75b / 8673994 FlyBaseID:FBgn0261402 Length:605 Species:Drosophila melanogaster


Alignment Length:385 Identity:68/385 - (17%)
Similarity:129/385 - (33%) Gaps:105/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 PIFIKIRNYF----GRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQR 221
            |:.:.|:..|    .:|.:.| |.:.......|.|..|.:..     ||.      |.|..||..
  Fly   201 PLNVSIKEIFDFMNSKYRIQL-DTYARLGYQARQPLRDMLDC-----KFK------YIFRDRWSD 253

  Fly   222 PIVQGERMNLILL---------------RNMTLNGTINLAI--SLCGFETPSELGVFSDVYDMEE 269
            ....|..:..::|               |.:.|......::  .:|.|..|..:..     .:..
  Fly   254 GNATGGMIGDLILDKADLAIAPFIYSFDRALFLQPITKFSVFREICMFRNPRSVSA-----GLSA 313

  Fly   270 WYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMIS 334
            ...:.|.:..:.:....:::::|..|.|..|                |:.|..|...:|...::|
  Fly   314 TEFLQPFSGGVWLTFALLLLLAGCLLWVTFI----------------LERRKQWKPSLLTSCLLS 362

  Fly   335 GIMG--QSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPV 397
            ...|  |...::.| ::..::....|.:...::...|.:.:.:.|..:|....|...:||.||.:
  Fly   363 FGAGCIQGAWLTPR-SMGGRMAFFALMVTSYLMYNYYTSIVVSKLLGQPIKSNIRTLQQLADSNL 426

  Fly   398 TVFFEEA--ERFYLKHAWDRPIR--YIKDQLNFRET-----IEYNALRMGLNRSNAFSALTS--- 450
            .|..|..  .|.|::.:.:..:|  |.|..|..:.:     |...|..:.:.....|..:|.   
  Fly   427 DVGIEPTVYTRIYVETSEEPDVRDLYRKKVLGSKRSPDKIWIPTEAGVLSVRDQEGFVYITGVAT 491

  Fly   451 --EWM-------------------------IVAKRQ---ELFKQPIFTVQPELRVIQTSV 480
              |::                         ::|||.   ||.|      ..|||:::|.|
  Fly   492 GYEFVRKHFLAHQICELNEIPLRDASHTHTVLAKRSPYAELIK------LSELRMLETGV 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir75bNP_001137966.2 Periplasmic_Binding_Protein_Type_2 253..553 CDD:304360 53/321 (17%)
Lig_chan 343..585 CDD:278489 42/226 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.