| Sequence 1: | NP_648329.3 | Gene: | Ir67a / 39110 | FlyBaseID: | FBgn0036010 | Length: | 584 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001137966.2 | Gene: | Ir75b / 8673994 | FlyBaseID: | FBgn0261402 | Length: | 605 | Species: | Drosophila melanogaster | 
| Alignment Length: | 385 | Identity: | 68/385 - (17%) | 
|---|---|---|---|
| Similarity: | 129/385 - (33%) | Gaps: | 105/385 - (27%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly   161 PIFIKIRNYF----GRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQR 221 
  Fly   222 PIVQGERMNLILL---------------RNMTLNGTINLAI--SLCGFETPSELGVFSDVYDMEE 269 
  Fly   270 WYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMIS 334 
  Fly   335 GIMG--QSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPV 397 
  Fly   398 TVFFEEA--ERFYLKHAWDRPIR--YIKDQLNFRET-----IEYNALRMGLNRSNAFSALTS--- 450 
  Fly   451 --EWM-------------------------IVAKRQ---ELFKQPIFTVQPELRVIQTSV 480  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Ir67a | NP_648329.3 | None | |||
| Ir75b | NP_001137966.2 | Periplasmic_Binding_Protein_Type_2 | 253..553 | CDD:304360 | 53/321 (17%) | 
| Lig_chan | 343..585 | CDD:278489 | 42/226 (19%) | ||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 | 
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||