DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir60b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001137755.1 Gene:Ir60b FlyBaseID:FBgn0259185 Length:577 Species:Drosophila melanogaster

Alignment Length:589 Identity:124/590 (21%)
Similarity:250/590 (42%) Gaps:87/590 (15%)


  Fly    21 ILTSIYKDRHHETVLLLQHSQHGNASGLERFPW---------PVFSFNEQMDFYVRGKYNSEMLV 76
            ||.::..:..:..:||::     :||.:|.. |         |:.:||.....|::...|:.:|.
  Fly    24 ILNALENELQYRAILLVE-----SASEIESC-WEQKYIQGAVPILNFNANQSLYLKDALNTNILA 82

  Fly    77 LIWQTGNSDWDLDLWQALDRSLLNMRKV-RVLLLRKWEKIPTADVAATAEHLLFLHVAVIGQGNR 140
            |:....|.:   ...|||..:|.:||.. .:|.:....|:  .||.........|:|......:|
  Fly    83 LVCLNENVE---STMQALYENLEDMRDTPTILFVLSDSKV--QDVFLECLRRKMLNVLAFKGLDR 142

  Fly   141 --IYRLQPYAPQSWLQVDPIESPIF-------IKIRNYF--------GRYIVTLPDQFPPRSIVY 188
              :|..:.:             |.|       :.|..||        |..:.||||...||::||
  Fly   143 GFVYSFRAF-------------PTFRVIERNVMDILQYFEQQLEDLGGHTLTTLPDNIIPRTVVY 194

  Fly   189 RNPKTDEIQMTGYVYKFLLEFIRIYNFTFR--W----QRPIVQ-GERMNLILLRNMTLNGTINLA 246
            ::|.... |:.||:|.||..::...|.|.:  |    :..::| ||.:.|..:.:      ::..
  Fly   195 KSPDGSR-QLAGYLYPFLRNYVSTINATLKVCWHLVPEDGMIQLGEVVRLSEIHD------VDFP 252

  Fly   247 ISLCGFETPSELGVFSDV-YDMEEWYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDT 310
            :.:.|.|..|   ...:| .::..|::|:|....:|.|..::::.......||:    :.|||.:
  Fly   253 LGMHGIEHGS---TSQNVPLEVSSWFLMLPMEPSLSRAQFFIMLGFEKVTPVLL----LLTILLS 310

  Fly   311 CFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKT 375
            ....:.:..|..|...:|.:|::.|.:||:|.:..|.::...:..:.:.|.|...|......|:|
  Fly   311 TAHRIEMGLRPSWRCYVLGDRVLQGTLGQAFFLPRRLSVKLMLVYSLILLNGFTFSNYSITSLET 375

  Fly   376 LLTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQL-------NFRETIEYN 433
            .|...|:...|.:::|:|...:.|....:|...:..|..:........|       ||::.    
  Fly   376 WLVHPPSGHPIHSWEQMRTLNLKVLIVPSELDSMTKALGKQFTESNSDLFELSKSGNFQDK---- 436

  Fly   434 ALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHIND 498
              |:.:::|.|:....:.|.::...|....:|.|....|: |:...:::::.:..||::...:|.
  Fly   437 --RLAMDQSYAYPVTCTLWPLLEHAQIRLPKPEFRRSREM-VLIPLLIMAMPLPKNSMFHKSLNR 498

  Fly   499 LIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFREFKVGDLFWIWLLWVSFLFMSFVIF 563
            .......:|:.|:|..::..|::.:..|..|....:..:|:|:..|..::||.:|.....|.::.
  Fly   499 YRALTHQSGLYEFWFKRSFNELVALRKIHYKVNGDHQIYRDFEWQDFSYVWLGFVGGTIASILVL 563

  Fly   564 LCEL 567
            |.|:
  Fly   564 LAEI 567



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.