DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir100a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_651898.2 Gene:Ir100a FlyBaseID:FBgn0039879 Length:603 Species:Drosophila melanogaster

Alignment Length:687 Identity:131/688 (19%)
Similarity:227/688 (33%) Gaps:237/688 (34%)


  Fly    21 ILTSIYKDRHHETVLLLQHSQHGNASGLERFPWPVFSFNEQMDFYVRGKYNSEMLVLIWQTGNSD 85
            :||||.|.......|.|:.|:.|                                      ||  
  Fly    28 VLTSIVKQLEGGLELHLRTSEDG--------------------------------------GN-- 52

  Fly    86 WDLDLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLFL-------------------- 130
               ||.|     .|...|..:::..|.|::|:.  |....|..|:                    
  Fly    53 ---DLVQ-----FLMQEKSSIIISAKQEEVPSR--AKIMRHHFFIFDGVHQMQEIRTSLFNTDGF 107

  Fly   131 HVAVIGQGNRI---YRLQPYAPQSWLQVDPIESPIFIKIRNYF---GRYIVTLPDQFPPRSIVYR 189
            ::..: :.|.|   ..|..:|...|||..        ..|.|:   .:..|.|.:.|..|.:|.:
  Fly   108 YILAL-ENNTIEDDVLLMEFAADVWLQHG--------HSRIYYVQLSKKSVLLFNPFLQRLVVVQ 163

  Fly   190 NPKTDEIQMTGYVYKFLLEF-IRIYNFTFRWQRPIVQGERMNLIL-------------------- 233
            :.||     ...:||.|..: :|||.|...:...|..||  |.:|                    
  Fly   164 DSKT-----YSRIYKDLEGYHLRIYIFDSVYSSVIGDGE--NKVLSVTGADAKLAKTVARQLNFT 221

  Fly   234 --------------LRNMTLNGTINLA------ISLCGFETPSELGV---FSDVYDMEEWYIMVP 275
                          |.|...:|.:..|      |...||.....|..   ||....|:|..:.|.
  Fly   222 ADFVWPDDEFFGGRLANGEYSGGVGRAHRGEVDIIFAGFFIKDYLTTHIQFSAAVYMDELCLYVK 286

  Fly   276 RAQEI--SIADVYVVMVSG--NFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGI 336
            :||.|  ||..::.|.:..  .||:|.::...::.||...             ||:|.   |.|:
  Fly   287 KAQRIPQSILPLFAVHMDVWLCFLLVGLLGALVWLILRAV-------------NLILG---IEGV 335

  Fly   337 MGQS-------FNMSARNTI------------------SSKVTNATLFLLGLVLSTLYAAHLKTL 376
            ...|       |..:.|..:                  |.::..|:|.|:.::...|..:.|.|:
  Fly   336 PDGSRATRISYFGAARRIFVDTWVIWVRVNVGRFPPFHSERIFVASLCLVSVIFGALLESSLATV 400

  Fly   377 LTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNR 441
            ..:....:.::..::|.:|        .:..|:||.            .|::.:.|.      :.
  Fly   401 YIRPLYYRDVNTLRELDES--------GQPIYIKHP------------AFKDDLFYG------HN 439

  Fly   442 SNAFSALTSEWMIVAKRQELFKQPI------------FTVQ-PELRVIQTSVL-----------L 482
            |..:..|.::.|:||:.:|...:.:            .::| .::|.:.|..:           :
  Fly   440 SEVYRRLDAKMMLVAEGEERLIEMVSKRGGFAGVTRSASLQLSDIRYVMTKKVHKIPECPKNYHI 504

  Fly   483 SLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFREFKVGDLFW 547
            :.|:...|.|.:.:|.::.|:.:.|||..|..:. :|.....:  |:.| .|:|  |..||....
  Fly   505 AYVLPRPSPYLEEVNRIVLRLVAGGIVGLWTGEA-KERAKWSI--QRFP-EYLA--ELDVGRWKV 563

  Fly   548 IWLLWVSFLFMSFVIFLCELLVDCFISKTLIRNKRPH 584
            :.|..|...|.:..|......:.|.....|.|.:|.|
  Fly   564 LTLSDVQLAFYALTIGCLLSAIVCMAEILLGRQRRLH 600

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir100aNP_651898.2 Periplasmic_Binding_Protein_Type_2 210..>255 CDD:304360 4/45 (9%)
Lig_chan <439..580 CDD:278489 30/147 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.