DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir94g

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_651147.2 Gene:Ir94g FlyBaseID:FBgn0039079 Length:545 Species:Drosophila melanogaster

Alignment Length:595 Identity:121/596 (20%)
Similarity:232/596 (39%) Gaps:127/596 (21%)


  Fly    22 LTSIY-----KDRHHETVLLLQHSQHGNASGLERFPWPVFSFNEQMDFYVRGKYNSEMLVLIWQT 81
            ||||:     |::.|     |:.:......||     |:..:.......:.|.....:|||....
  Fly    22 LTSIFFYAPAKEKCH-----LEDTISSATWGL-----PLVIWRTDRTVILNGFIGEGLLVLACLP 76

  Fly    82 GNSDWDLDLWQA----LDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIY 142
            |..      |:|    |.|||..:|:.|:|:    |.:...|....:|.|.|.....:...|.|:
  Fly    77 GFH------WRALLGSLARSLKYLRQARILI----ELMQDRDEFLVSEVLQFCLSQDMINVNAIF 131

  Fly   143 -------RLQPYAPQSWLQV-------DPIESPIF-IKIRNYFGRYIVTLPDQFPPRSIVYRNPK 192
                   .|..:......:|       |...|.:: .|:.|..|..|.|:||...|.:|:|:: |
  Fly   132 DDFPETENLSSFEAYPSFEVVNQTFTPDTQVSDLYPNKMLNLRGGVIRTMPDYSEPNTILYQD-K 195

  Fly   193 TDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIVQGERMNLILLRNMTLNGTINLAISLCGFETPSE 257
            ....::.||::..|..:...:|...:..........:|.|.|.:...:|.|::..|:    .|..
  Fly   196 EGNKEILGYLWDLLEAYAHKHNAQLQVVNKYADDRPLNFIELLDAAQSGIIDVGASI----QPMS 256

  Fly   258 LGVFSDVYDME------EWYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLL 316
            :|..|.:::|.      .|..|:|..:::.::::...::....|.:|::.:..:.:|        
  Fly   257 MGSLSRMHEMSYPVNQASWCTMLPVERQLHVSELLTRVIPYPTLALLLLLWIFYEVL-------- 313

  Fly   317 LKERVDWSNLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRP 381
               |..|..                        .|::.:....:|..::|:.|...|..|.|..|
  Fly   314 ---RGRWRR------------------------HSRLQSIGWLVLATLVSSNYVGKLLNLFTDPP 351

  Fly   382 TSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNA------------ 434
            :...:::...|.:|||.:.               .||.....:.|.:..:|:|            
  Fly   352 SLPPVNSLAALMESPVRII---------------SIRSEYSAIEFTQRTKYSAAFHLALHASILI 401

  Fly   435 -LRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHIND 498
             ||...|.|..::..:.:|.|..::|:...:|:|....:| .....:...||:..||.:...::.
  Fly   402 GLRNAFNTSYGYTITSEKWKIYEEQQKRSSKPVFRYSKDL-CFYEMIPFGLVIPENSPHRAPLHS 465

  Fly   499 LIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFR-EFK---VGDLFWIWLLWVSFLFMS 559
            ....::.||:.::|.::....|:..|.|:    |..|..| |.|   :.||..:::::||.|.:|
  Fly   466 YTLLLRQAGLHDFWVNRGFSYMVKAGKIN----FTAVGERYEAKTLTITDLRNVFIIYVSVLLIS 526

  Fly   560 FVIFLCELLV 569
            .::|.|||.|
  Fly   527 LILFTCELFV 536



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.