DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir76a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster

Alignment Length:606 Identity:113/607 (19%)
Similarity:221/607 (36%) Gaps:178/607 (29%)


  Fly    25 IYKDRHHETVLLLQHSQHGNASGLE----RFPWPVFSFN---EQMDFYVRGKYNSEMLVLIWQTG 82
            |::|:.:   :|:..||:.|:|..|    ||..| .:||   |.::||:..:::::.....|:|.
  Fly   151 IFQDQPN---ILVITSQYLNSSTFEIKTNRFVGP-RNFNKNPEPVEFYILQRFDAKGTKATWETQ 211

  Fly    83 NSDWDLDLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPY 147
            :         |:...:.|::...|                           |||    |:..:|:
  Fly   212 S---------AMSSKMRNLKGREV---------------------------VIG----IFDYKPF 236

  Fly   148 APQSWLQVDPIESPIFIKIRNYFGRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRI 212
                 :.:|..:.|:      |:.|::                 .|.::.:.|...:.:|.|..:
  Fly   237 -----MLLDYEKPPL------YYDRFM-----------------NTTDVTIDGTDIQLMLIFCEL 273

  Fly   213 YNFTFR--WQRPIVQGERMNLILLRNMTLNGTINLAISLCGFETPSELGVFSDVYDMEEWYIMVP 275
            ||.|.:  ...|...|:     :..|.:..|.:.:.:     :..::.|| ..:|...|.|..:.
  Fly   274 YNCTIQVDTSEPYDWGD-----IYLNASGYGLVGMIL-----DRRNDYGV-GGMYLWYEAYEYMD 327

  Fly   276 RAQEISIADVYVVMVSGNFLI--VLIIFYFIFTILDTCFGPLLLKE--------RVDWSNLMLNE 330
            ....:..:.|..::.:.|.||  .|::..|.| :|..|....||.|        |.:.|::....
  Fly   328 MTHFLGRSGVTCLVPAPNRLISWTLLLRPFQF-VLWMCVMLCLLLESLALGITRRWEHSSVAAGN 391

  Fly   331 RMISGI-------MGQSFNMSARNTISSKVTNATL---FLLGLVLSTLYAAHLKTLLTKRPTSQQ 385
            ..||.:       :....|.|.....||......|   :::.::|:|:|:..|..:|| .||.::
  Fly   392 SWISSLRFGCISTLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILT-LPTLEE 455

  Fly   386 ISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNA---LRMGL-------- 439
            .::.:|                   ..:|..:.:......:..||:..:   :.:||        
  Fly   456 AADSRQ-------------------RLFDHKLIWTGTSQAWITTIDERSADPVLLGLMEHYRVYD 501

  Fly   440 -NRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIY----------- 492
             |..:|||.......:|.:.|       |.......:|:...|..|.:..:.||           
  Fly   502 ANLISAFSHTEQMGFVVERLQ-------FGHLGNTELIENDALKRLKLMVDDIYFAFTVAFVPRL 559

  Fly   493 EDHI---NDLIHRVQSAGIVEYWKHQTLREMITMG-----MISQK---DPFPYVAFREFKVGDLF 546
            ..|:   ||.|....|:|..::|:.:...|.:...     :.|:|   |..|.    :..:.:..
  Fly   560 WPHLNAYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKTNLDIGPV----KLGIDNFI 620

  Fly   547 WIWLLWVSFLFMSFVIFLCEL 567
            .:.|||...:..|.:.||.||
  Fly   621 GLILLWCFGMICSLLTFLGEL 641



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.