DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir68b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster

Alignment Length:623 Identity:108/624 (17%)
Similarity:194/624 (31%) Gaps:242/624 (39%)


  Fly    51 FPWPVFSFNEQMDFYVRGKYNSEMLVLIWQTG--NSDWDLD--LW------QALDRSLLNMRKVR 105
            |.||....::.:..: ||.:..::|..:..||  |..:|.|  .|      |.||..:...|||:
  Fly   123 FVWPNAGRHQLLRLF-RGSWAKKLLYGLAITGRENGTFDFDPFAWGGLQVIQRLDGEVPYARKVK 186

  Fly   106 VLL---LR------KWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDPIESP 161
            .|.   ||      ....:|.:.|....      :.||.|...|:......|..:::..:..|| 
  Fly   187 DLRGYPLRFSMFTDPLMAMPRSPVETAG------YQAVDGVAARVVGEMLNASVTYVFPEDNES- 244

  Fly   162 IFIKIRNYFGR------YIVTLPD------QFPPRSIVYRNPKTDEIQMTGYVYKFLLEFI---- 210
                    :||      |...:.|      .|.|.|                  :|:|:.|    
  Fly   245 --------YGRCLPNGNYTGVVSDIVGGHTHFAPNS------------------RFVLDCIWPAV 283

  Fly   211 -RIYNFTFRWQRPIVQGERMNLILLRNMTLNGTINLAISLCGFETPSELGVFSDVYDMEEWYIMV 274
             .:|.:|.|                         ||.:.:.......|..:|..|:....||:: 
  Fly   284 EVLYPYTRR-------------------------NLHLVVPASAIQPEYLIFVRVFRRTVWYLL- 322

  Fly   275 PRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERV----------DWSNL--M 327
                                |:.|::...:|.::..      |:.|:          .|..:  |
  Fly   323 --------------------LVTLLVVVLVFWVMQR------LQRRIPRRGVIQFQATWYEILEM 361

  Fly   328 LNERMISGIMGQSFNMSARNTISSKVTNATLFLLG-----LVLSTLYAAHLKTLLTKRPTSQQIS 387
            ..:..:....|:..:.|:..|          ||:|     .||||:|.|.|::...:....:|:.
  Fly   362 FGKTHVGEPAGRLSSFSSMRT----------FLMGWILFSYVLSTIYFAKLESGFVRPSYEEQVD 416

  Fly   388 NFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGL---------NRSN 443
            ....|....|.:                          :..|..|:|:|..|         |||.
  Fly   417 RVDDLVHLDVHI--------------------------YAVTTMYDAVRSALTEHQYGLLENRSR 455

  Fly   444 --AFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNS------IYEDHINDLI 500
              .....||.:..|.:|::  ::..|.    :|.......|::...|.:      |..:::..:|
  Fly   456 QLPLGIATSYYQPVVRRRD--RRAAFI----MRDFHARDFLAITYDSQAERPAYHIAREYLRSMI 514

  Fly   501 ------------HRVQSA-------GIVEYWKHQTLREMIT-MGMISQKDPF------------- 532
                        ||::|.       |..|:|:..   ::|| :|.....:.|             
  Fly   515 CTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQM---DLITRVGASPDAEEFLEDLGDQTDTDSG 576

  Fly   533 -PYVAFREFKV-------GDLFWIWLLWVSFLFMSFVI 562
             ..:|.|..||       ...|::|.:.:....:.|.:
  Fly   577 SNELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAV 614

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 55/325 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.