DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir68a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_648455.2 Gene:Ir68a FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster

Alignment Length:767 Identity:132/768 (17%)
Similarity:237/768 (31%) Gaps:289/768 (38%)


  Fly     2 LPILVP---------VLLLFNETSWINPI---LTSIYKDRHH--------ETVLLLQHSQHGNAS 46
            :||..|         :.:|..:..|:..:   ...|..|.|:        |:|            
  Fly    22 IPIANPAPLSGYEMQLKILLQKILWVANVKRCFAVITDDLHYPIYDRIFFESV------------ 74

  Fly    47 GLERFPWPVFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDLDL------WQA-------LDRSL 98
            |....|:.|...||..|..   :.:.::.:.:....:||.:|::      ||.       .|...
  Fly    75 GRRVIPFFVMRTNESDDLQ---RPSRQVELFVKAIKSSDCELNVITILNGWQVQRFLGYIYDNRS 136

  Fly    99 LNMRKVRVLL--LRKWE----------------------KIPTADVA---ATAEHLLFLHVA--V 134
            |||:|..|||  ||.:|                      |...:.:|   ..:..|:..::|  .
  Fly   137 LNMQKKFVLLHDLRLFESDMIHLWSVFIDAIFLKRQLDNKYTISTIAFPGILSGVLVMKNIANWE 201

  Fly   135 IGQG--NRI---------------YRLQPYAPQ-SWLQVDPIESPIFIKIRNYFGRYIVTLPDQF 181
            :|:|  .||               ..:..:.|. .|.........:.::|.|..|:.:...|..:
  Fly   202 LGKGLNGRILFADKTSNLFGTSLPVAISEHVPMVLWANATKSFQGVEVEIMNALGKALNFKPVYY 266

  Fly   182 PPR--------------SIVYRNPKTDEIQMTG--------------------------YVYKFL 206
            .|.              |:.|.:...|.....|                          .||..|
  Fly   267 KPNQTENMDWTELDGGASVAYGSGNPDGYAQNGTHIDSMLVDEVAAHSARFAIGDLHLFQVYLKL 331

  Fly   207 LEFIRIYNF---TF---------RWQR---PIVQGERMNLIL-------------LRNMTLNGTI 243
            :|....:||   ||         .||.   |...|..:.::|             ..|..:||.:
  Fly   332 VELSAPHNFECLTFLTPESSTDNSWQTFILPFSAGMWVGVLLSLFVVGTVFYAISFLNAIINGNV 396

  Fly   244 NLAISLCGFETPSELGVFSDVYDMEEWYIMVPRAQEI-------SIADVYV--VMVSGNFLI--- 296
            :.....| ......:.:...:|....:.|.:.|.:..       .:.|.|.  ::::.:.|:   
  Fly   397 SSEFFRC-LRPNRNVPMDPKIYRRISFRIAISRYRSSKGDRMPRDLFDGYTNCILLTYSMLLYVA 460

  Fly   297 -----------VLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTIS 350
                       ||..:|:|:.||      |:...|..::.::.|.             :||.||.
  Fly   461 LPRMPRNWPLRVLTGWYWIYCIL------LVATYRASFTAILANP-------------AARVTID 506

  Fly   351 SKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDR 415
            :             |..|..:|:       |.|...:..:|        ||.||.        |.
  Fly   507 T-------------LEDLLRSHI-------PPSTGATENRQ--------FFLEAN--------DE 535

  Fly   416 PIRYIKDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQ---------P 471
            ..|.:.:::   |...|:            ..|||.   :||.|..:....|.::         .
  Fly   536 VARKVGEKM---EVFGYS------------DDLTSR---IAKGQCAYYDNEFYLRYLRVADESGS 582

  Fly   472 ELRVIQTSVL---LSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFP 533
            .|.:::..||   :.|.|:.||..:..::..|..:...|::..|....:..:....:..|:    
  Fly   583 ALHIMKECVLYMPVVLAMEKNSALKPRVDASIQHLAEGGLIAKWLKDAIEHLPAEALAQQE---- 643

  Fly   534 YVAFREFKVGDLFWIWLLWVSF--LFMSFVIFLCELLVDCFISKTLIRNKRP 583
                      .|..|...|.||  |.:.:||.:..||.:.:..|.::. |.|
  Fly   644 ----------ALMNIQKFWSSFVALLIGYVISMLTLLAERWHFKHIVM-KHP 684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 54/319 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.