DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir67b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_648393.1 Gene:Ir67b FlyBaseID:FBgn0036083 Length:574 Species:Drosophila melanogaster

Alignment Length:609 Identity:127/610 (21%)
Similarity:212/610 (35%) Gaps:156/610 (26%)


  Fly    12 FNETSWI-NPILTSIYKDRHHE---TVLLLQHSQHGNASGLERFPWPVFSFNEQMDFYVRGKY-- 70
            |..|.|| ||....:.|.....   |:|.|:                    :|.:|   ||.|  
  Fly    55 FVPTLWIKNPQNQKVMKGNFTSCTLTILYLE--------------------DEHLD---RGLYYL 96

  Fly    71 ------NSEMLVLIWQTGNSDWDLDLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLF 129
                  ...:.|||:..|.| :| .|.|...| ..|...|.||::     :|.:|          
  Fly    97 ANWLWEYHHLEVLIFFNGGS-YD-KLIQIFSR-CFNEGFVNVLVM-----LPGSD---------- 143

  Fly   130 LHVAVIGQGNRIYRLQPYAPQSWLQVDPIESPIFIKIRNY-FGRYIVT--LPDQFPPRSIVYRNP 191
                      .:|...||.....|.:..|:....:..:.. ...|.:|  |.....||...:|: 
  Fly   144 ----------ELYTFMPYQDLKILNLKSIKEFYSLSRKKMDLNGYNITSGLVIAGAPRWFSFRD- 197

  Fly   192 KTDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIVQGERMNLI----------LLRNMTLNGTIN-L 245
            :.:.:.:|||:.:.:::|...:|.:.|....:...:.:.|:          |:|.:......| |
  Fly   198 RQNRLILTGYMLRMIVDFTNHFNGSVRLMNVLTVNDGLELLANRTIDFFPFLIRPLKSFSMSNIL 262

  Fly   246 AISLCGFETPSELGVFSDVYDMEEW-YIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILD 309
            .:..||...|:.       ..:..| |::.|.|.:..||          :||:||.......||.
  Fly   263 YLENCGLIVPTS-------RPLPNWVYLLRPYAFDTWIA----------WLIMLIYCSLALRILS 310

  Fly   310 TCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLL------GLVLSTL 368
                    |.::..|...|.      ::.....:|....:.::.|...|||.      |.:|:.|
  Fly   311 --------KGQISISAAFLK------VLRLVMYLSGSRDMGTRPTTRRLFLFVILTTSGFILTNL 361

  Fly   369 YAAHLKTLLTKRPTSQQISNFKQLRDSP-----VTVFFEEAERFYLKHAWDRPIRYIKDQLNFRE 428
            |.|.|.:........:||:.::.|..|.     :.|..:..|:.            |.|:....:
  Fly   362 YVAQLSSNSAAGLYEKQINTWEDLDKSDSIWPLIDVDIKTMEKL------------IPDRTKLLK 414

  Fly   429 TI------EYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQ 487
            .|      :.:..|..||.|...|...........:|:..:.|||...|.|...|.   |.:...
  Fly   415 KIVPTLEADVDTYRRNLNTSCIHSGFFDRIDFALYQQKFLRFPIFRKFPHLLYQQP---LQISAA 476

  Fly   488 SNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFR----EFKVGDLFWI 548
            ....|....|..:.::..:||....|....|..|..|:::       :|||    |.|..|:.:.
  Fly   477 FGRPYLQLFNWFVRKIFESGIYLKMKDDAYRHGIQSGLLN-------LAFRDRHLEVKSNDVEYY 534

  Fly   549 WL---LWVSFLFMSFVIFLCELLV 569
            :|   ||...|.::.|.||.|||:
  Fly   535 YLIAGLWFGGLTLATVCFLLELLI 558



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.