DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir60e

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_611927.3 Gene:Ir60e FlyBaseID:FBgn0035019 Length:572 Species:Drosophila melanogaster

Alignment Length:529 Identity:121/530 (23%)
Similarity:221/530 (42%) Gaps:53/530 (10%)


  Fly    60 EQMDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQALDRSLLNMRKVRVLLLRKWEK-IPTADVAAT 123
            |..|..:||.:....|::: ...:||.:..:...|.|.|..:.::.::.|...|. .|..|:...
  Fly    73 EARDLRIRGNFTESTLIIV-SVMDSDLNPLVASLLPRLLDELHELHIVFLSNEEPGFPKQDLYTY 136

  Fly   124 AEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDPIE----SPIFIK---IRNYFGRYIVTLPDQF 181
            .....|::| ::..|..:|...||.     .:.||.    |..|.:   |||:.|..:..|....
  Fly   137 CFKEGFVNV-ILMSGKGLYSYLPYP-----SIQPISLSNVSEYFDRARIIRNFQGFPVRILRSTL 195

  Fly   182 PPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIVQGERMNLIL-LRNMTLNGTINL 245
            .||...|.|.:...:: .||::..:.|....||.|.. ..||......::.| :..|.....|::
  Fly   196 APRDFEYSNEQGGLVR-AGYLFTAVKELTYRYNATIE-SVPIPDLPEYDVYLAVAEMLHTKKIDI 258

  Fly   246 AISLCGFETPSELGVFSDVYDMEEWYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDT 310
               :|.|:..|....::....:...|.|.|.|:.|| :.:|.....|..|..::    |.|:|  
  Fly   259 ---VCYFKDFSLEVAYTAPLSIIREYFMAPHARPIS-SYLYYSKPFGWTLWAVV----ISTVL-- 313

  Fly   311 CFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTIS---SKVTNATLFLLGLVLSTLYAAH 372
             :|.::|......:.:.:.:.::..:....:|...:..::   ....:..|.:.|.:|:.:|.|.
  Fly   314 -YGTVMLHLAARGARVEIGKCLLYSLSHILYNCHQKIRVAGWRDVAIHGILTIGGFILTNVYLAT 377

  Fly   373 LKTLLTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRM 437
            |.::||.....::.:..:.|..:|.....:|..|..:|.....|.|..::.|:...|: ..|.|.
  Fly   378 LSSILTSGLYDEEYNTLEDLARAPYPSLHDEYYRSQMKAKTFLPERLRRNSLSLNATL-LKAYRD 441

  Fly   438 GLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSV--LLSLVMQSNSI-YEDHINDL 499
            |||:|..:........::..:|.|.|.|.|      .:|:.:|  .|.....|||: |....::.
  Fly   442 GLNQSYIYILYEDRLELILMQQYLLKTPRF------NMIRQAVGFTLESYCVSNSLPYLAMTSEF 500

  Fly   500 IHRVQSAGIVEYWKHQTLREMITMGM--ISQKDPFPYVAFREFKVGDL---FWIWLLWVSFLFMS 559
            :.|:|..||....|..|.||:|..|:  :.:.|..|..||      ||   |:.::||...|..|
  Fly   501 MRRLQEHGISIKMKADTFRELIHQGIYTLMRDDEPPAKAF------DLDYYFFAFVLWTVGLISS 559

  Fly   560 FVIFLCELL 568
            .::|..||:
  Fly   560 LLVFFAELV 568



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.