| Sequence 1: | NP_648329.3 | Gene: | Ir67a / 39110 | FlyBaseID: | FBgn0036010 | Length: | 584 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_611901.1 | Gene: | Ir60a / 37881 | FlyBaseID: | FBgn0034994 | Length: | 716 | Species: | Drosophila melanogaster |
| Alignment Length: | 575 | Identity: | 105/575 - (18%) |
|---|---|---|---|
| Similarity: | 192/575 - (33%) | Gaps: | 177/575 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 ALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDP 157
Fly 158 IE----SPIFIKIRNYFGRYIVTLPDQFP--------PRSI-------VYRNPKTDEIQMTGYVY 203
Fly 204 KFLLEFIRIYNFTF----RWQRPIVQ-----GERMNLILLRNMTLNGTINLAISLCGFETPSELG 259
Fly 260 -------------------VF---------------SDVY--DMEEWYIMV----PRAQE-ISIA 283
Fly 284 DVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNT 348
Fly 349 ISSKVTNAT----------LFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFK------QLRDSPV 397
Fly 398 TV--------------FFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAFSAL 448
Fly 449 TSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWK 513
Fly 514 HQTLREMITMGMISQKDP-FPYVAF---REFKVGDLFWIWL--LWVSFLFMSFVI 562 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||