DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir60a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_611901.1 Gene:Ir60a FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster

Alignment Length:575 Identity:105/576 (18%)
Similarity:192/576 (33%) Gaps:177/576 (31%)


  Fly    93 ALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDP 157
            ::|| |..:.|.:::.:|.|.        ..|..|:..|       |...|.:|....|.:..|.
  Fly   149 SVDR-LKELMKKKIVEMRSWN--------PGARFLVLFH-------NATCRNRPLGVASNIFKDL 197

  Fly   158 IE----SPIFIKIRNYFGRYIVTLPDQFP--------PRSI-------VYRNPKTDEIQMTGYVY 203
            :|    ..:.:...|....|.:.:.|.:.        .:|:       :|.|....:..|..||.
  Fly   198 MEMFYVHRVALLYANSTMNYNLLVNDYYSNVNCRILNVQSVGQCHDGKLYPNNAVVKASMQDYVS 262

  Fly   204 KFLLEFIRIYNFTF----RWQRPIVQ-----GERMNLILLRNMTLNGTINLAISLCGFETPSELG 259
            .|...     |.||    ....|.|:     |..|.::......|...:|   ..|..|:..|:.
  Fly   263 GFSPR-----NCTFFACSSISAPFVEADCILGLEMRILGFMKNRLKFDVN---QTCSLESRGEMD 319

  Fly   260 -------------------VF---------------SDVY--DMEEWYIMV----PRAQE-ISIA 283
                               ||               ||.|  |...|||.:    |..|. :.|.
  Fly   320 GPANWTGLLGKVQNNECDFVFGGYYPDNEVADHFWGSDTYLQDAHTWYIKMADRRPAWQALVGIF 384

  Fly   284 DVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNT 348
            :.|..:  |..||::|.:.|.||::      ::|.|...:               |..:::|.|.
  Fly   385 EAYTWI--GFILILIISWLFWFTLV------MILPEPKYY---------------QQLSLTAINA 426

  Fly   349 ISSKVTNAT----------LFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFK------QLRDSPV 397
            ::..::.|.          ||.:.|   |||.  |..:.|.  ||:.|:.|:      ||.:...
  Fly   427 LAVTISIAVQERPICETTRLFFMAL---TLYG--LNVVATY--TSKMIATFQDPGYLHQLDELTE 484

  Fly   398 TV--------------FFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAFSAL 448
            .|              :||..:..::.:.::....:|....|. |.:::....:..||.....:.
  Fly   485 VVAAGIPFGGHEESRDWFENDDDMWIFNGYNISPEFIPQSKNL-EAVKWGQRCILSNRMYTMQSP 548

  Fly   449 TSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWK 513
            .:: :|.|....:|..|:                .::|::...:...:|.:|..::..||.:...
  Fly   549 LAD-VIYAFPNNVFSSPV----------------QMIMKAGFPFLFEMNSIIRLMRDVGIFQKID 596

  Fly   514 HQTLREMITMGMISQKDP-FPYVAF---REFKVGDLFWIWL--LWVSFLFMSFVI 562
            .........:..|::..| ||..|.   .|...|..|.:.:  .|.:..|:..:|
  Fly   597 ADFRYNNTYLNRINKMRPQFPETAIVLTTEHLKGPFFILVVGSCWAALTFIGELI 651



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.