DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir48c

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_610700.1 Gene:Ir48c FlyBaseID:FBgn0033651 Length:561 Species:Drosophila melanogaster

Alignment Length:563 Identity:113/564 (20%)
Similarity:200/564 (35%) Gaps:169/564 (30%)


  Fly    55 VFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQALD--RSLLNMRKVRVLLL--RKWEKI 115
            :.|.|...:|..   |:.|.:::|.:. ..|.:|:| ..||  ||.|..|:...:||  ...|.:
  Fly    59 IISHNISEEFKT---YHDEPVLIIIRL-ERDLNLNL-ATLDVLRSYLTDRQYNDILLIDNDEENL 118

  Fly   116 PT-ADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDPIESPIFIK---IRNYFGRYIVT 176
            .: .|:.....:..|..|.:.....|.:.::||   .:||:.|.....:|:   .||..|..:..
  Fly   119 NSYVDIRKAYWNAGFSQVLIYNSQQRTWSIKPY---PYLQIRPTSLKEYIENRNTRNLMGYPLRV 180

  Fly   177 LPDQFPPRSIVYRNPKTDEIQMTGYVYK-FLLEFIRIY----NFTFRWQRPIVQGERMNL----- 231
            |....||...|.:    ||:..:...|| .::..::|:    |.||: ..|..:..|.:.     
  Fly   181 LVTNDPPHCFVDK----DELPGSPNRYKGSIVTMLKIFADQLNATFQ-ANPFREFRRYSTADCVQ 240

  Fly   232 ------------ILLRNMTLNGT----INLAISLCGFETPSELGVFSDVYDMEEWYIMVPRAQEI 280
                        |.:|..|...:    :|..:.:..|..|.|          :.:|...|     
  Fly   241 MVSDDEIDACGSIFIRTYTYATSQPVRLNRVVIMAPFGNPIE----------KFYYFFRP----- 290

  Fly   281 SIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLL----LKERVDWS---NLMLNERMISGIMG 338
              .|:||.:.:|     :|:.|.      ...|.||    .||   |:   .|:|   .:..::.
  Fly   291 --FDLYVWIGTG-----IIVVYI------AVMGSLLHRWHFKE---WNVGQYLLL---AVQTLLN 336

  Fly   339 QSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPVTVFF-- 401
            :..::...::.|..:....||.:|.:||.||.|.|..:||.:...:.|.|...|:.:.|.:..  
  Fly   337 RELSLPQSSSGSKFMLLLLLFAIGFILSNLYVALLSMMLTTKLYQRPIENLADLKAANVNILLQT 401

  Fly   402 -------------EEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAF-------- 445
                         |..|||.|.                 |..::...|.||:.|.|:        
  Fly   402 HNIRPNSVYGSSEELRERFLLV-----------------EESQHLEKRNGLDPSYAYVDSEDRMD 449

  Fly   446 SALTSEWMIVAKRQELFKQPI---FTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHR----- 502
            ..|..:..:..:|.:....|:   :.||              |::.|.:.|.|.||.:.|     
  Fly   450 FYLYQQKFLRRRRMKKLSNPVGYTWAVQ--------------VIKQNWVLEKHYNDHVQRFFETG 500

  Fly   503 ------------VQSAGIVEYWKHQT-------LREMITMGMI 526
                        ...||.:.::..||       |.:::...|:
  Fly   501 LQNKLVDDVHELAVKAGFLHFFPTQTQTIEPLRLEDIVMAAMV 543



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.