DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir48b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_610697.1 Gene:Ir48b FlyBaseID:FBgn0033648 Length:600 Species:Drosophila melanogaster

Alignment Length:649 Identity:120/650 (18%)
Similarity:231/650 (36%) Gaps:184/650 (28%)


  Fly     1 MLPILVPVLLLFNETSWINPILTSIYKDRHHETVLLLQHSQHGNASG---------LERFPWP-- 54
            :|.:|:.:.:....|..:|.|:..:     ::.:|:..:..:.|.|.         |:..| |  
  Fly     9 LLKLLLLLAISSVRTQGLNDIIIEL-----NQRLLISNNFLYCNQSDKLNEYEIKYLQHMP-PIS 67

  Fly    55 --VFSFNEQMDF----YVRGKYNSEMLVLIWQTGNSDWDLDLWQALDRSL------------LNM 101
              :|:..|.|:|    |..|..|...|::    ||.:...|...||:...            :::
  Fly    68 LMIFTSIESMNFTQVEYNLGADNKLFLIM----GNEEPPYDFLHALNLHFQFAEYIIVIDEPVDL 128

  Fly   102 RK----------------VRVLLLRKWEK-------IPTADVAATAEHLLFLHVAVIGQGNRIY- 142
            :|                |::|:...:::       .|...:..|   |:..::::.|..|.:| 
  Fly   129 KKSTKWLDFVNHLWQQGYVQLLIYTSYDEKLYHKIIFPETVIEET---LVEQYISIRGSFNNLYG 190

  Fly   143 ---RLQPY--APQSWLQVDPIESPIFIKIRNYFGRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYV 202
               |:..|  ||:|.|.|            |.:|::|                       ..|:.
  Fly   191 YPVRVAAYNNAPRSMLYV------------NRWGKHI-----------------------FAGFY 220

  Fly   203 YKFLLEFIRIYNFTFRWQRPIVQGERMNLILLRNMTLNGTINLAISLCGFETPSELGVFSDVYDM 267
            .:||..||...|.:|   .|::......    .|.||| .:|..:.:|.....:....||     
  Fly   221 MRFLRAFIDARNGSF---VPVLTPSNSP----GNCTLN-LVNETVDVCADALAANPAAFS----- 272

  Fly   268 EEWYIMVPRAQEISIADVYVV----MVSGNFLI--------VLIIFYFIFTILDTCFGPLLLKER 320
                  :.....|:.|:|.|.    :.|..:|.        ..::.|.:..:....|...|...:
  Fly   273 ------LTHGFRIASANVLVTHAKPLHSYRYLTAPFQWSVWACLVIYVLLVVNFLSFIGWLRSGK 331

  Fly   321 VDWSNLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQ 385
            .::|..:|  .:.|.::...|.:.........:....||:.|.|.||.|...||::|......:|
  Fly   332 WEFSKYLL--EVFSSLLFSGFYLKEIRGRERYILFGVLFIAGFVYSTEYLGLLKSMLISEVFEKQ 394

  Fly   386 ISNFKQLRDSPVTVFFEEAER-FYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRSNAFSALT 449
            |..|:.|.:|.:|:..:..:: .:.|:.....:..|.:.::|...:::   |...::..|:...:
  Fly   395 IDTFEALVESNITLMVDPYDKILFAKYNMPEILSPIMELVSFETLLKH---RNRFDQDYAYILFS 456

  Fly   450 SEWMIVAKRQELFKQPIFTVQPELRV-IQTSVLLS-LVMQSNSIYEDHINDLIHRVQSAGIVEYW 512
            ....:....|:..|.|..     ||: |..|.|.: :.|:.....:.|:          |...||
  Fly   457 DRMALYDYAQQFLKHPKL-----LRIPIDFSFLYTGIPMRKRWFLKHHL----------GRAWYW 506

  Fly   513 KHQTLREMITMGMISQKDPFPYVAFREFKVGDLFWIWLLWVSFLFMSFVIFLCE---LLVDCFI 573
            ..::   .:|..:....|      |...:||        ::|||....|    |   |.||.|:
  Fly   507 AFES---GLTRKLALDAD------FEAVRVG--------YLSFLITEHV----EAQPLNVDYFV 549



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.