DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir40a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_610140.4 Gene:Ir40a FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster

Alignment Length:558 Identity:99/559 (18%)
Similarity:181/559 (32%) Gaps:189/559 (34%)


  Fly     8 VLLLFNETSWINPILTSIYKDRH--HETVLLLQHSQHGNASGLERFPWP----VFSFNEQMDFYV 66
            :.|:.:|.   |.:|.|:: |||  |...|.:.:      .|..   ||    |..|.|.:...|
  Fly   109 ISLILDEP---NQLLNSLH-DRHLGHRLSLFIFY------WGAR---WPPSSRVIRFREPLRVVV 160

  Fly    67 RGKYNSEMLVLIWQTGN--SDWDLDLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLLF 129
            ..:...:...:.:....  ||..|.|....|...|.::::.:|        |||           
  Fly   161 VTRPRKKAFRIYYNQARPCSDSQLQLVNWYDGDNLGLQRIPLL--------PTA----------- 206

  Fly   130 LHVAVIGQGNRIYRLQPYAPQSWLQVDPIESPIFIKIRNYFGRYIVTLPDQFPPRSIVYRNPKTD 194
            |.|....:| |.:|:..:....|..|        ....|.|..     .::|.....:.:.    
  Fly   207 LSVYANFKG-RTFRVPVFHSPPWFWV--------TYCNNSFEE-----DEEFNSLDSIEKR---- 253

  Fly   195 EIQMT-GYVYKFLLEFIRIYNFTFRW-QRP------------------------IVQGERMNLIL 233
            ::::| |..::.|:...:..||.|:: :.|                        ::|..:.:..|
  Fly   254 KVRVTGGRDHRLLMLLSKHMNFRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQADFFL 318

  Fly   234 LRNMTLNGTINL------AISLCGFETPSELGVFSDVYDM---EEWYIMVPRAQEISIADVYVVM 289
                   |.:.|      ||.. .|.|.::.|.|:.....   |...||.|..|:|....:..::
  Fly   319 -------GDVGLSWERRKAIEF-SFFTLADSGAFATHAPRRLNEALAIMRPFKQDIWPHLILTII 375

  Fly   290 VSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSN--------LMLNERMISGIMGQSFNMSAR 346
            .||.      |||.|..:      |.:.:.|  |:|        |.::...:..|..:...:..|
  Fly   376 FSGP------IFYGIIAL------PYIWRRR--WANSDVEHLGELYIHMTYLKEITPRLLKLKPR 426

  Fly   347 NTISSKVTNATL------FLLGL----------------------------VLSTLYAAHLKTLL 377
            ..:|:......|      |.|.|                            ||:.:|:|.|.:..
  Fly   427 TVLSAHQMPHQLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYWIAATYVLADVYSAQLTSQF 491

  Fly   378 TKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEYNALRMGLNRS 442
            .:......|:..::|:    .....:..|.|::.                   |.::|.|..|.:
  Fly   492 ARPAREPPINTLQRLQ----AAMIHDGYRLYVEK-------------------ESSSLEMLENGT 533

  Fly   443 NAFSALTSEWMIVAKRQELFKQP----IFTVQPELRVI 476
            ..|..|     ....||::...|    |.:|:..:::|
  Fly   534 ELFRQL-----YALMRQQVINDPQGFFIDSVEAGIKLI 566

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 22/147 (15%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 23/114 (20%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 16/100 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.