DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir10a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_001096949.1 Gene:Ir10a FlyBaseID:FBgn0083979 Length:600 Species:Drosophila melanogaster

Alignment Length:674 Identity:143/675 (21%)
Similarity:250/675 (37%) Gaps:185/675 (27%)


  Fly     2 LPILVPVLLLF-------NETSWINPILTSIYKDRHHETVLLLQHSQHGNASG--------LERF 51
            :.:|..|.|||       |.|. :|.:|....:|.....:.|...|.|.:|..        ....
  Fly     1 MAVLGTVFLLFMLDLKTLNLTR-LNGLLVEPTRDLPQLELWLRAGSDHQDAENPYVQWFLLRTEI 64

  Fly    52 PWPVFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQALDRSLLN------MRKVRVL--L 108
            |..:.::.|.. :::...:....|||:             .:||:.|.|      ::|....  :
  Fly    65 PLSIVTYQENR-YWMDDPFGRRNLVLV-------------MSLDQLLTNRGAAAPIQKASTFFYI 115

  Fly   109 LRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQ----------------VDP 157
            |...:|..:||     |.|               ||:....|.|.|                .||
  Fly   116 LADQDKDLSAD-----EQL---------------RLEGSCRQLWTQHKVYNRFFLTRDGVWIYDP 160

  Fly   158 IE--SPIFIKIRNYFG---------RYIVTLPDQFPPRSIVYRNPKTDE-----IQMTG---YVY 203
            .:  ...|.::..|:|         |.:...|.:......||..|:.|:     .::||   .|.
  Fly   161 FKRRDSAFGRLVRYYGSETLDKLLFRDMAGYPLRIQMFRSVYTRPEFDKETGLLTRVTGVDFLVA 225

  Fly   204 KFLLEFIRIYNFTFRWQRPIVQ--GERMNLILLRNMTLNGTI------NLAISLCGFETPSEL-G 259
            :.|.|.:   |||...|:|..:  |||.     .|.:.||.|      .|.|.|.||.....| .
  Fly   226 QMLRERL---NFTMLLQQPEKKYFGERS-----ANGSYNGAIGSIIKDGLDICLTGFFVKDYLVQ 282

  Fly   260 VFSD----VYDMEEWYIMVPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKER 320
            .:.|    ||| :|..|.||:|..|..:.:.:..|..:..:..::..|...::......:.||.|
  Fly   283 QYMDFTVAVYD-DELCIYVPKASRIPQSILPIFAVGYDIWLGFVLTAFACALIWLTLRVINLKLR 346

  Fly   321 VDWSNLML-NERMIS---GIMGQSFNMSARNTIS-------SKVTNATLFLLGLVLSTLYAAHLK 374
            :    :.| |:.::.   |||..::.:..|..:|       .::...||.|:.::...::.:.|.
  Fly   347 I----VSLGNQHIVGQALGIMVDTWVVWVRLNLSHLPASYAERMFIGTLCLVSVIFGAIFESSLA 407

  Fly   375 TLLTKRPTSQQISNFKQLRDSPVTV-----------FFEEAERFYL----KHAWDRPIR--YIKD 422
            |:.......:.|:..::|.:|.:.|           ||.|....:.    |.:|:|.:|  .|.:
  Fly   408 TVYIHPLYYKDINTMQELDESGLKVVYKYSSMADDLFFSETSPLFASLNKKLSWNRDLRADVIDE 472

  Fly   423 QLNFRETIEYNALRMGLNR-------SNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSV 480
            ...||.       :.|::|       |:.|:.|...|::                ||.....|  
  Fly   473 VARFRN-------KAGVSRYTSLILESSHFTLLRKIWVV----------------PECPKYYT-- 512

  Fly   481 LLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGM---ISQKDPFPYVAFREFKV 542
             :|.||..:|.:||.:|.|:.|..:||::..| .|..:..:.:.|   |.:.|....:. |...:
  Fly   513 -ISYVMPRDSPWEDAVNALLLRFLNAGLIVKW-IQDEKSWVDIKMRSNILEADAESELV-RVLTI 574

  Fly   543 GDLFWIWLLWVSFLFMSFVIFLCE 566
            |||...:.:.:....::|:.||.|
  Fly   575 GDLQLAFYVVIGGNLLAFLGFLAE 598

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ir67aNP_648329.3 None
Ir10aNP_001096949.1 Periplasmic_Binding_Protein_Type_2 220..>294 CDD:304360 25/83 (30%)
TM_PBP1_branched-chain-AA_like 315..>411 CDD:294309 17/100 (17%)
Lig_chan 319..587 CDD:278489 59/300 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.