| Sequence 1: | NP_648329.3 | Gene: | Ir67a / 39110 | FlyBaseID: | FBgn0036010 | Length: | 584 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_732700.2 | Gene: | Ir94b / 318728 | FlyBaseID: | FBgn0051424 | Length: | 592 | Species: | Drosophila melanogaster |
| Alignment Length: | 633 | Identity: | 137/633 - (21%) |
|---|---|---|---|
| Similarity: | 259/633 - (40%) | Gaps: | 137/633 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 FNETSWINPILTSIYKDRHHETVLLLQHS-------QHGNASGLERFPWPVFSFNEQMDFYVRGK 69
Fly 70 YNSEMLVLIWQTGNSDWDL----------------DLW----------QALDRSLLNMRKVRVLL 108
Fly 109 LRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDPIESP---IFIKIR-NY 169
Fly 170 FGRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKF---------LLEFIRIYNFTFRWQRPIVQ 225
Fly 226 GERMNLILLRNMTL--NGTINLAISLCGFETPSELG---VFSDVYDMEEWYIMVPRAQEISIADV 285
Fly 286 YVVMVSG--NFLIVLIIFYFIFTILDTCF-GPLLLKERVD----WSNLMLNERMISGIMGQSFNM 343
Fly 344 SARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPVTVFFE-EAERF 407
Fly 408 YLKH-AWDRPIRYI--KDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTV 469
Fly 470 QPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPY 534
Fly 535 VAFREFKVGDLFWIWLLWVSFLFMSFVIFLCELLVDCFISKTLIRNKR 582 |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | P | PTHR42643 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||