DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir94b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_732700.2 Gene:Ir94b FlyBaseID:FBgn0051424 Length:592 Species:Drosophila melanogaster

Alignment Length:633 Identity:137/634 (22%)
Similarity:259/634 (41%) Gaps:137/634 (22%)


  Fly    12 FNETSWINPILTSIYKDRHHETVLLLQHS-------QHGNASGLERFPWPVFSFNEQMDFYVRGK 69
            |.:..::|.|:.|:.|....||:::::|.       |:.||.|:     .:...|:|....::..
  Fly    23 FLQLKYLNNIVRSMIKLHKMETLVIVKHHLDNNCSLQNWNAHGM-----GIIRTNDQGKLIMKDT 82

  Fly    70 YNSEMLVLIWQTGNSDWDL----------------DLW----------QALDRSLLNMRKVRVLL 108
            :||..|.:|....||...|                .||          |.:.:...:::.:.:|:
  Fly    83 FNSRTLAIICIGQNSHITLLRNVFETFGKVQQKKIILWTQMELKEKFFQEISKKSRDLKLLNLLV 147

  Fly   109 LRKWEKIPTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQSWLQVDPIESP---IFIKIR-NY 169
            |:          |.|.:.||            ||||.|:....:.:::.|.:|   :|:..: |:
  Fly   148 LK----------AVTKDKLL------------IYRLNPFPSPHFKRIENIWTPNDTLFMDTKFNF 190

  Fly   170 FGRYIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKF---------LLEFIRIYNFTFRWQRPIVQ 225
            .|            .:.|.::.....||| |.:.||         ::||...||.|.::...:  
  Fly   191 HG------------MTAVVKHDYNWTIQM-GNIRKFPISRIEDKEVIEFALKYNLTLQFFNDV-- 240

  Fly   226 GERMNLILLRNMTL--NGTINLAISLCGFETPSELG---VFSDVYDMEEWYIMVPRAQEISIADV 285
             ||.::.|.:.:.|  |.|           .|.:.|   |||.:      .|:||....:||.| 
  Fly   241 -ERFDIELRKRIILKSNST-----------QPIDSGIPMVFSSL------LIVVPCGNYLSIQD- 286

  Fly   286 YVVMVSG--NFLIVLIIFYFIFTILDTCF-GPLLLKERVD----WSNLMLNERMISGIMGQSFNM 343
             |:.|||  .::..:|:.|.||.:::..| |..:|..|..    ..|.::|......|:|..|..
  Fly   287 -VIKVSGIEKWIFYIILVYVIFVLIEITFLGVTILISRQSRHQMIPNTLVNLCAFRAILGLPFPE 350

  Fly   344 SARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPVTVFFE-EAERF 407
            :.|.::|.:.....:.|.|::.|......|.::||......|::||::|:.|.:||..: :||.|
  Fly   351 TRRTSLSLRQLFLAIALFGMIFSIFINCKLSSMLTNPCPRPQVNNFEELKTSGLTVVMDHDAENF 415

  Fly   408 YLKH-AWDRPIRYI--KDQLNFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTV 469
            ..|. ..|...:|:  |..|.|.|..:   |...|..::||:..:..:.|:...|..........
  Fly   416 IEKEIGVDFFNQYMPRKVTLTFTERAK---LLFSLKGNHAFTLFSESFAIIESYQRSKGLRAHCT 477

  Fly   470 QPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPY 534
            ..:| ::...|....::::|||.:..:...|.::|.:||..:|. :.:...:...::....|:..
  Fly   478 SEDL-IVAERVPRIYILENNSILDRPLRRFIRQMQESGITNHWL-KNIPSSLEKNLMQITIPYDR 540

  Fly   535 VAFREFKVGDLFWIWLLWVSFLFMSFVIFLCELLVDCFISKTLIRNKR 582
            .......:..|.|:|.:.:....:|.::|        |:..:|.|.|:
  Fly   541 ERVHPLSIEHLTWLWCILILGYSISMIVF--------FVEMSLKRRKK 580



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.