DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir94c

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_732701.2 Gene:Ir94c FlyBaseID:FBgn0051423 Length:604 Species:Drosophila melanogaster

Alignment Length:645 Identity:136/646 (21%)
Similarity:254/646 (39%) Gaps:148/646 (23%)


  Fly     4 ILVPVLLLFNETSWINP-------ILTSIYKDRHHETVLLLQHSQ-------HGNASGLERFPWP 54
            :::|::.|.......||       ::..|.:.|...|:::::||:       ..|..|.     |
  Fly     8 LVLPLIYLSLTKGSKNPQLKFLRELINVIEEGREIRTIMVIKHSRDEYCHLDQWNPRGS-----P 67

  Fly    55 VFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDL--DLWQALDRSLLNMRKVRVLLLRKW-EKIP 116
            :...||.....:.|.:|.:.::|.....|||:.|  .|..|:|    |||:.|::|   | |:.|
  Fly    68 ILRTNEMGSIRISGYFNDQAVILACMGENSDYGLLKSLANAMD----NMRQERIIL---WSEREP 125

  Fly   117 TA----DVAATAEHLLFLHVAVIGQGN------RIYRLQPYAPQSWLQVDPIESPIFIKIRNYFG 171
            |.    .::..|:...|..:.::....      .:::|.||....:.|:..|.:   |:..::||
  Fly   126 TKMLMDYISQQADRYNFAQIIIVTMNEDVDAVPSLHQLNPYPTPRFRQITNISN---IRRTSFFG 187

  Fly   172 RYIVTLPDQFPPRSIVYRNPKTDEIQM-----TGYVYKFLLEFIRIYNFTFRWQRPIVQGERMNL 231
            ..:     .|..::.:.:......|:.     :|.:....|:...|..|..::            
  Fly   188 CGL-----SFQGKTAILKESVVSNIRFKVWSPSGPIPLSELKDYEIVQFAVKY------------ 235

  Fly   232 ILLRNMTLNGTINLAISLCGFETPSELGVFSDVYDME-----------------------EWYIM 273
                        ||::.|.. :..|:    ||.:|::                       ...::
  Fly   236 ------------NLSLKLYD-QNESK----SDHFDIQLGPLFITKDFPTQMAFVSPNTACSLIVI 283

  Fly   274 VPRAQEISIADVYVVMVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWS-------NLMLNER 331
            ||.:.:....||...:.....:..|:|.|.:|.:::|..  |.|..|:...       |.:||.|
  Fly   284 VPCSPKWRFMDVLHKLGVLKLIGCLLIAYAVFVLIETLI--LWLTHRISGREVRLTSLNQLLNPR 346

  Fly   332 MISGIMGQSFNMSARNTISSKVTNATLFLLGLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSP 396
            ...||:|..|....|::||.:.....:.:.|||.|...:..|..||||...:.|:.|||:||||.
  Fly   347 AFRGILGLPFPEFRRSSISLRQLFLVISVFGLVYSNFVSCTLSALLTKPAQNPQVRNFKELRDSG 411

  Fly   397 -VTVFFEEAERFYLKHAWDRPIRYIKDQLNFRETIEY-------NALRM--GLNRSNAFSALTSE 451
             :|:..:....|..||.         |...|...:.:       .||||  ..|.|.::...|:.
  Fly   412 LITIMDKYTHSFIEKHI---------DPEFFDHVLPHYLILQKKEALRMIWNFNDSYSYVMYTTT 467

  Fly   452 WMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQT 516
            |..:...|:.|.:.:| .:.|...|..::....|:.:||:.:..::..|..:...||.:.|..| 
  Fly   468 WKSLNTVQKSFDERVF-CESESLTIAWNLPRMYVLGNNSVLKWMLSRYITYMPQTGIPDSWTEQ- 530

  Fly   517 LREMITMGMISQKDPFPYVAFREFKVG-------DLFWIWLLWVSFLFMSFVIFLCELLV 569
            |.:::.: :.:...|      |..|.|       .|.|||.|......::.::|:.|:|:
  Fly   531 LPKVLKL-LYNVTSP------RRIKEGAVPLSIQHLSWIWHLLFIGESIATLVFIVEILL 583



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.