DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir94f

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_732868.2 Gene:Ir94f FlyBaseID:FBgn0051225 Length:558 Species:Drosophila melanogaster

Alignment Length:616 Identity:133/617 (22%)
Similarity:229/617 (37%) Gaps:148/617 (24%)


  Fly    32 ETVLLLQHSQHGNASGLERFPWP----VFSFNEQMDF----------YVRGKYNSEMLVLIW--Q 80
            :.|||.:.|....:..|:|| |.    ...|...:::          .|.|..||  ..|:|  |
  Fly     3 QQVLLAETSNWFRSDVLQRF-WTHLRVEIRFRTMLNYRLESCDCWFDNVLGSDNS--TALLWNDQ 64

  Fly    81 T------GNSDWDL------------DLWQALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHL 127
            |      ...|.|:            ::..||...|..||.:.|:|....::....::  .:..|
  Fly    65 TYPHYLRRRQDTDILVVSCLRFHQYQEVLLALSLMLDQMRSMPVVLQLCGDEDSMQEL--NSARL 127

  Fly   128 LFLHVAVIGQGNRI--------------------YRLQPYAPQSWLQVDPIESPIFIKIRNYFGR 172
            |..|...:...|.:                    :.:|....|::|.:.|      .|:.|..|.
  Fly   128 LLKHSQDLKMPNVVLLSSTFFTSATLYSYEMFPEFNVQKLVYQAYLTLFP------YKLGNLKGH 186

  Fly   173 YIVTLPDQFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIV--QGERMNLILLR 235
            .|.|:||...|.:|| |......|.:.|.|::|::||.:..|.|.  |.||.  ..:.:.|:.:.
  Fly   187 PIRTVPDNSEPLTIV-RKTLNGSIAIDGLVWQFMIEFAKHINATL--QLPIEPHPEKSIKLVQIL 248

  Fly   236 NMTLNGTINLAISLCGFE---TPSELGVFSDVYDMEEWYIMVPRAQEISIADVYV-VMVSGNFLI 296
            ::..|.|:::|.||..:.   ..|...::.....:..|.:|:|..:.|...:... :|.|....:
  Fly   249 DLVRNQTVDIAASLRPYSLNVQRSSTHIYGSPMMVGNWCMMLPTERVIGSHEALTRLMKSPWTWL 313

  Fly   297 VLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTISSKVTNATLFLL 361
            :|::||.:...|                                   :.:..:.|.:.:....|:
  Fly   314 ILLLFYSVHRFL-----------------------------------AQKTRLRSSLIHLIKLLI 343

  Fly   362 GLVLSTLYAAHLKTLLTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAWDRPIRYIKDQL-- 424
            .|.|.....|.|............|||.:|:.:|.:.:.....|  ::::..|...||....|  
  Fly   344 NLSLICFLQAQLSAYFIGPQKVNHISNMQQVEESGLKIRGMRGE--FMEYPIDMRSRYASSFLLH 406

  Fly   425 -NFRETIEYNALRMGLNRSNAFSALTSEWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQS 488
             .|.:..:|   |..||.|..::..:.:|.:..:.|..|::|:|....|: .:|...|.||:.||
  Fly   407 DLFFDLAQY---RNSLNTSYGYTVTSVKWELYKEAQRHFRRPLFRYSEEI-CVQKLSLFSLIQQS 467

  Fly   489 NSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKDPFPYVAFREFKVGDLFWI----- 548
            |.||.......|.|:..||::..|..::...|:|.|              .|.:|||..:     
  Fly   468 NCIYCYRSRIFILRMHEAGLIRLWYRRSYYVMVTAG--------------RFPIGDLSTVHRAQP 518

  Fly   549 --WLLW--------VSFLFMSFVIFLCELLV 569
              |..|        |..|| |.|:|:.||.|
  Fly   519 IRWTEWQNVVLLHGVGLLF-SVVVFVIELTV 548



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_2C043
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.