DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir7a

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_572406.1 Gene:Ir7a FlyBaseID:FBgn0029961 Length:614 Species:Drosophila melanogaster

Alignment Length:631 Identity:130/632 (21%)
Similarity:229/632 (36%) Gaps:182/632 (29%)


  Fly     3 PILVP---VLLLFNETSWINPI---LTSIYKDRHHETVLLLQHSQHGNASGLE----------RF 51
            |..||   |:.|.|.....|.:   .|.|:..|....::||.|.....|..|:          ||
  Fly    89 PAEVPASFVVFLVNSAQAFNTLGFHFTDIHSTREFNFLILLTHRMSSRAERLQVLRDISRTCVRF 153

  Fly    52 PWP-VFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQALDRSLLNMRKVRVLLLRKWEKI 115
            ... |....|:.|..|        ||..::..|.|.||    :::..|:::.|            
  Fly   154 HTSNVILLTEKRDGVV--------LVYAYRLLNMDCDL----SVNLELIDIYK------------ 194

  Fly   116 PTADVAATAEHLLFLHVAVIGQGNRIYRLQPYAPQ-SWLQVDPIESPIFIKIRNYFGRYIVTLPD 179
                      :.||.|.......||:..|.....| ||..:.|..|        :.|.  .:.|:
  Fly   195 ----------NGLFRHGHEARSFNRVLSLSGCPLQVSWYPLPPFVS--------FIGN--SSDPE 239

  Fly   180 QFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTFRWQRPIVQGERMNLILLRN-------- 236
            :   |:.::|....|     |.:.|.|...     |.||    |:..|..|..|..:        
  Fly   240 E---RAQIWRLTGID-----GELIKLLASI-----FDFR----ILLEEPCNKCLSPDIKDDCSGC 287

  Fly   237 ----MTLNGTINLAISLCGFETPSELGVFSDVYDMEEWYIMVPRAQEISIAD--------VYVVM 289
                :..|.:|.:.......:..|.....|..:.....:||...:|..::|.        |::.:
  Fly   288 FDQVIISNSSILIGAMSGSHQHRSHFSFTSSYHQSSLVFIMHMSSQFGAVAQLAVPFTVIVWLAL 352

  Fly   290 VSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDWSNLMLNERMISGIMGQSFNMSARNTISS--- 351
            |..:.|:||:::          ....|:..|.|.::..|  ::::.:||..  :.||:...|   
  Fly   353 VVSSLLLVLVLW----------MRNRLVCGRSDLASHAL--QVLTTLMGNP--LEARSLPRSSRL 403

  Fly   352 KVTNATLFLLGLVLSTLYAAHL---KTLLTKRPTSQQISNFKQLRDSPVTVFFEEAERFYLKHAW 413
            ::..|...||.|||..:|...|   ..|...:|...:||   :|..|..|:..:|    ||.: :
  Fly   404 RILYAGWLLLVLVLRVVYQGKLFDSFRLPYHKPLPTEIS---ELIRSNYTLINQE----YLDY-Y 460

  Fly   414 DRPIRYI-----KDQLNFRETIEYNALRMGLNRSNAFSA----LTSEWMIV----AKRQELFKQP 465
            .|.:..:     ||:.::.:         ||.:...|:.    .|.|:..:    ..|....|:.
  Fly   461 PRELTVLTRNGSKDRFDYIQ---------GLGKEGKFTTTSLIATMEYYNMMHWSTSRLTHIKEH 516

  Fly   466 IFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQTLREMITMGMISQKD 530
            ||..|           :.:.::.:|:.:...:..|.::.||||:.|:    :||   ......:.
  Fly   517 IFLYQ-----------MVIYLRRHSLLKFAFDRKIKQLLSAGIIGYF----VRE---FDACQYRK 563

  Fly   531 PFPYVAFREFKVG--------DLFWIWLLWVSFLFMSFVIFLCELL 568
            ||.    .:::|.        .|::|.|:|:|   .:.|.|:.|||
  Fly   564 PFE----EDYEVTPIPLDSFCGLYYISLIWLS---AAVVAFILELL 602



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.