DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ir67a and Ir51b

Sequence 1:NP_648329.3 Gene:Ir67a FlyBaseID:FBgn0036010 Length:584 Species:Drosophila melanogaster
Sequence 2:NP_725440.1 Gene:Ir51b FlyBaseID:FBgn0050081 Length:597 Species:Drosophila melanogaster

Alignment Length:640 Identity:134/641 (21%)
Similarity:253/641 (39%) Gaps:131/641 (20%)


  Fly     1 MLPILVPVLLL------FNET-------------SWIN-PILTSIYKDRHHET-------VLLLQ 38
            :|.:||.:|||      :|.|             .||| ||...      |.|       :::..
  Fly     4 VLTLLVVILLLALTNAAYNVTLLKSVLSLISTREPWINTPIFVG------HNTQGGDLNDLIIWL 62

  Fly    39 HSQHGNAS-GLERFPWP----------VFSFNEQMDFYVRGKYNSEMLVLIWQTGNSDWDLDLWQ 92
            |...|..| .:..|..|          :..:|....|:...|::.                 :|.
  Fly    63 HQTMGVTSLTMNLFLQPEHIRPLGHFKITRYNGIALFFCHDKHDI-----------------MWL 110

  Fly    93 ALDRSLLNMRKVRVLLLRKWEKIPTADVAATAEHLL----FLHVAVIGQGNRIYRLQPYAPQSWL 153
            .|||:|..:|::|::::.:.::..:.....:..:.|    ||:|.|: |.:::|...||....:.
  Fly   111 TLDRNLRKLRRIRLIIILRNQRSGSQGAIKSIFNALWQYQFLNVLVL-QRDQLYSYTPYPAMRFF 174

  Fly   154 QVDPIESPIFIKIRNYFGRYIVTLP-DQFPPRSIVYRNPKTDEIQMTGYVYKFLLEFIRIYNFTF 217
            ::|....|:|......|..|:|:.| :...||.....:|.|...::.||.|:..:|::..||.:.
  Fly   175 KLDIHTEPLFPHAARNFHGYVVSTPAENDIPRVFHVHDPLTKSRKVLGYAYRTFVEYLDHYNASL 239

  Fly   218 RWQRP---IVQGERMNLILLRNMTLNGTINLAISLCGFETPS-----ELGVFSDVYDMEEWYIMV 274
            |...|   :.....:|:..:..:.::|.:.:::....|..|:     .|.::.:.       ::|
  Fly   240 RLTNPDENLDPTTSVNMNHIVQLIIDGQLEISLHPYVFTPPTATKSYPLLIYPNC-------LIV 297

  Fly   275 PRAQEISIADVYVV---MVSGNFLIVLIIFYFIFTILDTCFGPLLLKERVDW-SNLMLNERMISG 335
            |...||. ..:|::   .:...::::..:||  .|.:..|..|.|.|.  .| ..|.||  .:..
  Fly   298 PMRNEIP-RHMYLLRPFQLYSWYILLFAVFY--ITGILYCISPKLNKS--SWPQRLGLN--FLDA 355

  Fly   336 IMGQSFNMSARNTISSKVT-------NATLFL----LGLVLSTLYAAHLKTLLTKRPTSQQISNF 389
            |....|       ||..:|       :..:||    ||.:.::.|...|.:..|.....:|:::.
  Fly   356 ISKILF-------ISPPITIYRPTWRHLIIFLQLSVLGFMSTSWYNIELDSFFTTIVVGEQVNSM 413

  Fly   390 KQLRDSPVTVFFEEAE-RFYLKHAWDRPIRYIKDQL---NFRETIEYNALRMGLNRSNAFSALTS 450
            .||......|..:|.| ..:|:|...|.:..:...|   |..|.:  :|| :..|||.|:.....
  Fly   414 DQLVHQQQRVLVKEYEINTFLRHVEPRLVEKVSRLLVPVNASEQV--SAL-LSFNRSFAYPFTEE 475

  Fly   451 EWMIVAKRQELFKQPIFTVQPELRVIQTSVLLSLVMQSNSIYEDHINDLIHRVQSAGIVEYWKHQ 515
            .|...|.:|:...:|||...   .....|..:...|:.:|..|..:|..|.::|..|::.:|...
  Fly   476 RWQFFAMQQQYAFKPIFRFS---SACLGSPHIGYPMRVDSHLETSLNHFILKIQDTGLLNHWVVS 537

  Fly   516 TLREMITMGMISQKDPFPYVAFREFKVGDLFWIWLL----WVSFLFMSFVIFLCE 566
            ...:.:..|.:...|  ..:.::...|..|...|.:    |:    :|.::|.||
  Fly   538 DFNDAMRAGYVRFVD--NVLGYQSIDVDTLRLGWCVLGIGWI----LSALVFSCE 586



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR42643
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.