DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or67a and Or59c

DIOPT Version :10

Sequence 1:NP_524005.2 Gene:Or67a / 39109 FlyBaseID:FBgn0036009 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523823.1 Gene:Or59c / 37716 FlyBaseID:FBgn0034866 Length:411 Species:Drosophila melanogaster


Alignment Length:51 Identity:13/51 - (25%)
Similarity:21/51 - (41%) Gaps:4/51 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 TENIQRKRSRGKSSSSSLPLDLTSEIFSRLPAKSVVRFRCVSKLWSSITTA 58
            |.|..::..:.|    .|..|:...|.|:|.....||.....:|:.|:..|
  Fly   185 TVNFSKEADKAK----PLDYDMAERIESQLQITEQVRSLHREQLFKSLVDA 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or67aNP_524005.2 7tm_6 75..396 CDD:251636
Or59cNP_523823.1 7tm_6 79..385 CDD:251636 13/51 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.